BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0020 (389 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_13168| Best HMM Match : Ribosomal_S26e (HMM E-Value=0) 152 1e-37 SB_56656| Best HMM Match : VWA (HMM E-Value=3.8e-26) 27 7.2 SB_10952| Best HMM Match : Exo_endo_phos (HMM E-Value=4.1e-08) 27 7.2 SB_43935| Best HMM Match : 7tm_1 (HMM E-Value=0) 27 7.2 >SB_13168| Best HMM Match : Ribosomal_S26e (HMM E-Value=0) Length = 289 Score = 152 bits (368), Expect = 1e-37 Identities = 71/98 (72%), Positives = 81/98 (82%) Frame = +3 Query: 21 MTRKRRNGGRAKHGRGHVKAVRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDINDASVYP 200 MT+KR NGGR+KHGRGHVK VRCTNCARCVPKDK+IKKFVIRNIVEAAAVRDI DASVY Sbjct: 1 MTKKRCNGGRSKHGRGHVKFVRCTNCARCVPKDKSIKKFVIRNIVEAAAVRDIADASVYE 60 Query: 201 MFQLPKLYAKLHYCVSCASTAKLSGTDRRKTEESVLLP 314 ++ LPKLY KLHYCVSCA +K+ +R K + + P Sbjct: 61 VYALPKLYVKLHYCVSCAIHSKVV-RNRSKEDRKIRTP 97 Score = 41.9 bits (94), Expect = 2e-04 Identities = 17/20 (85%), Positives = 20/20 (100%) Frame = +2 Query: 254 LHSKVVRNRSKKDRRIRTPP 313 +HSKVVRNRSK+DR+IRTPP Sbjct: 79 IHSKVVRNRSKEDRKIRTPP 98 >SB_56656| Best HMM Match : VWA (HMM E-Value=3.8e-26) Length = 2157 Score = 26.6 bits (56), Expect = 7.2 Identities = 16/60 (26%), Positives = 26/60 (43%) Frame = +3 Query: 21 MTRKRRNGGRAKHGRGHVKAVRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDINDASVYP 200 M ++ N K+ R + TNC +K K +NI+ + D D+S+YP Sbjct: 1819 MLYRQNNWYYIKNSRNTEGFIPFTNCIAEDEYEKRQNKLSRQNIIRNTSFLDSMDSSIYP 1878 >SB_10952| Best HMM Match : Exo_endo_phos (HMM E-Value=4.1e-08) Length = 558 Score = 26.6 bits (56), Expect = 7.2 Identities = 19/46 (41%), Positives = 26/46 (56%), Gaps = 7/46 (15%) Frame = -1 Query: 203 HWVYRGIVN------ISDRRRFYDVPNHELFDGLVLWH-APRAVCA 87 H+ RGI N +S+RR+F V N E D +VL H P+A C+ Sbjct: 441 HYGIRGIANEWFSSYLSNRRQFVSVNNSE-SDEVVLTHGVPQAKCS 485 >SB_43935| Best HMM Match : 7tm_1 (HMM E-Value=0) Length = 842 Score = 26.6 bits (56), Expect = 7.2 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +3 Query: 108 VPKDKAIKKFVIRNIVEAAAVRDINDASVYPMFQLPKL 221 + K K + VI + A AV D++ +VYP+F P L Sbjct: 47 IVKKKRNEGKVIYLFIGALAVTDVSLLAVYPLFAFPVL 84 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,267,096 Number of Sequences: 59808 Number of extensions: 204561 Number of successful extensions: 492 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 469 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 492 length of database: 16,821,457 effective HSP length: 74 effective length of database: 12,395,665 effective search space used: 681761575 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -