BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0013 (616 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_05_0393 - 24632570-24632629,24633212-24633370,24633496-246336... 28 5.1 05_01_0166 + 1145829-1145971,1146211-1146235,1147330-1147425,114... 27 8.9 >05_05_0393 - 24632570-24632629,24633212-24633370,24633496-24633612, 24633697-24633831,24634140-24634337,24634449-24634529, 24634845-24635141,24635231-24636013,24636589-24636765 Length = 668 Score = 28.3 bits (60), Expect = 5.1 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = +3 Query: 66 WMDELTAHLFVKWLLEPKDIHNVN 137 W D +TA L LLEPKD+ +N Sbjct: 498 WKDPITAALAQSGLLEPKDVDPLN 521 >05_01_0166 + 1145829-1145971,1146211-1146235,1147330-1147425, 1147544-1147645,1147767-1147889,1147996-1148622, 1148710-1148883,1148965-1149181,1149312-1149394, 1149478-1149573,1149676-1149724,1149850-1150088, 1150547-1150618,1150694-1150804,1150930-1151282, 1151377-1151464,1151691-1151789,1151860-1151991, 1152119-1152222,1153179-1153215,1153334-1153367, 1153451-1153467 Length = 1006 Score = 27.5 bits (58), Expect = 8.9 Identities = 11/39 (28%), Positives = 20/39 (51%) Frame = -1 Query: 430 FCILIFIYNIYLNFCGRDINNFVXHVIIDGNRKFCKFYT 314 FC+ + +Y C ++F V++D + CKF+T Sbjct: 814 FCVTAYDRQLYNAVCKISKSSFQDKVVVDIDGVHCKFFT 852 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,203,066 Number of Sequences: 37544 Number of extensions: 192054 Number of successful extensions: 394 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 392 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 394 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1478421500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -