BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0010 (698 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 27 0.23 DQ435324-1|ABD92639.1| 152|Apis mellifera OBP3 protein. 23 2.8 AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly pro... 23 2.8 Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP... 22 4.9 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 22 4.9 AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase pro... 22 4.9 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 26.6 bits (56), Expect = 0.23 Identities = 16/43 (37%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = +2 Query: 332 TPSS-SNQNTEDEDDSGDNKASALSFKERRREAHTQAEQKRRD 457 TP S S + DED + D ++ L R RE H +Q+ RD Sbjct: 1399 TPLSISRAGSRDEDSTRD--STKLDRSSREREVHNGGQQEDRD 1439 >DQ435324-1|ABD92639.1| 152|Apis mellifera OBP3 protein. Length = 152 Score = 23.0 bits (47), Expect = 2.8 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = +2 Query: 338 SSSNQNTEDEDDSGDN 385 S++N NT E++S DN Sbjct: 135 SNANSNTTSEEESSDN 150 >AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly protein MRJP2 protein. Length = 452 Score = 23.0 bits (47), Expect = 2.8 Identities = 11/48 (22%), Positives = 22/48 (45%) Frame = +2 Query: 314 IQNIHQTPSSSNQNTEDEDDSGDNKASALSFKERRREAHTQAEQKRRD 457 I+N H ++ N N ++ ++ DN K ++ A+ Q + D Sbjct: 409 IRNTHCVNNNQNDNIQNTNNQNDNNQ-----KNNKKNANNQKNNNQND 451 >Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP57-1 protein. Length = 544 Score = 22.2 bits (45), Expect = 4.9 Identities = 10/48 (20%), Positives = 21/48 (43%) Frame = +2 Query: 329 QTPSSSNQNTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDAIKKG 472 Q + N N ++ + DNK + + ++ + Q K+ D + G Sbjct: 460 QNDNRQNDNKQNGNRQNDNKQNGNRQNDNKQNGNRQNGNKQNDNKQNG 507 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 22.2 bits (45), Expect = 4.9 Identities = 12/37 (32%), Positives = 19/37 (51%) Frame = +2 Query: 299 GSSGSIQNIHQTPSSSNQNTEDEDDSGDNKASALSFK 409 G+SGS + + S+NQ + ++ N S SFK Sbjct: 599 GASGSGSAENLSSGSNNQTSSASRENTSNTTSMESFK 635 >AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase protein. Length = 588 Score = 22.2 bits (45), Expect = 4.9 Identities = 10/31 (32%), Positives = 19/31 (61%) Frame = +2 Query: 446 KRRDAIKKGYDSLQDLVPTCQRVMRLATNQA 538 ++RD +KKG +++ L T V+R + +A Sbjct: 472 RKRDVLKKGNFTIEILNKTVLAVVRQSEEEA 502 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 180,275 Number of Sequences: 438 Number of extensions: 3679 Number of successful extensions: 17 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21439440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -