BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0010 (698 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g00050.1 68417.m00005 basic helix-loop-helix (bHLH) family pr... 43 2e-04 At3g23690.1 68416.m02979 basic helix-loop-helix (bHLH) family pr... 42 4e-04 At1g26260.2 68414.m03204 basic helix-loop-helix (bHLH) family pr... 42 5e-04 At1g26260.1 68414.m03203 basic helix-loop-helix (bHLH) family pr... 42 5e-04 At1g09530.2 68414.m01069 phytochrome interacting factor 3 (PIF3)... 42 5e-04 At1g09530.1 68414.m01068 phytochrome interacting factor 3 (PIF3)... 42 5e-04 At2g18300.2 68415.m02134 basic helix-loop-helix (bHLH) family pr... 41 0.001 At2g18300.1 68415.m02133 basic helix-loop-helix (bHLH) family pr... 41 0.001 At3g59060.2 68416.m06584 basic helix-loop-helix (bHLH) family pr... 40 0.001 At3g59060.1 68416.m06583 basic helix-loop-helix (bHLH) family pr... 40 0.001 At2g46970.1 68415.m05867 basic helix-loop-helix (bHLH) protein, ... 40 0.001 At1g73830.1 68414.m08548 basic helix-loop-helix (bHLH) family pr... 39 0.003 At4g28800.1 68417.m04118 bHLH family protein contains Pfam profi... 39 0.004 At4g27120.2 68417.m03898 expressed protein 39 0.004 At4g27120.1 68417.m03897 expressed protein 39 0.004 At1g18400.1 68414.m02298 basic helix-loop-helix (bHLH) family pr... 38 0.005 At2g20180.2 68415.m02360 basic helix-loop-helix (bHLH) family pr... 38 0.008 At2g20180.1 68415.m02359 basic helix-loop-helix (bHLH) family pr... 38 0.008 At4g36540.2 68417.m05189 basic helix-loop-helix (bHLH) family pr... 37 0.011 At4g36540.1 68417.m05188 basic helix-loop-helix (bHLH) family pr... 37 0.011 At3g07340.1 68416.m00875 basic helix-loop-helix (bHLH) family pr... 37 0.011 At2g43010.2 68415.m05338 phytochrome-interacting factor 4 (PIF4)... 37 0.011 At2g43010.1 68415.m05337 phytochrome-interacting factor 4 (PIF4)... 37 0.011 At1g68920.2 68414.m07888 basic helix-loop-helix (bHLH) family pr... 36 0.026 At1g68920.1 68414.m07887 basic helix-loop-helix (bHLH) family pr... 36 0.026 At5g61270.1 68418.m07689 basic helix-loop-helix (bHLH) family pr... 36 0.034 At1g10120.1 68414.m01141 basic helix-loop-helix (bHLH) family pr... 36 0.034 At4g34530.1 68417.m04907 basic helix-loop-helix (bHLH) family pr... 35 0.060 At1g25330.1 68414.m03143 basic helix-loop-helix (bHLH) family pr... 35 0.060 At3g57800.2 68416.m06443 basic helix-loop-helix (bHLH) family pr... 34 0.079 At1g69010.1 68414.m07896 basic helix-loop-helix (bHLH) family pr... 34 0.10 At1g59640.2 68414.m06708 basic helix-loop-helix (bHLH) family pr... 34 0.10 At1g59640.1 68414.m06707 basic helix-loop-helix (bHLH) family pr... 34 0.10 At4g28790.2 68417.m04116 basic helix-loop-helix (bHLH) family pr... 33 0.14 At4g28790.1 68417.m04117 basic helix-loop-helix (bHLH) family pr... 33 0.14 At5g48560.1 68418.m06005 basic helix-loop-helix (bHLH) family pr... 33 0.24 At3g57800.1 68416.m06442 basic helix-loop-helix (bHLH) family pr... 33 0.24 At2g42300.1 68415.m05236 basic helix-loop-helix (bHLH) family pr... 33 0.24 At5g62610.1 68418.m07857 basic helix-loop-helix (bHLH) family pr... 32 0.32 At5g38860.1 68418.m04700 basic helix-loop-helix (bHLH) family pr... 32 0.42 At3g19510.1 68416.m02472 homeobox protein (HAT 3.1) identical to... 32 0.42 At1g76180.1 68414.m08846 dehydrin (ERD14) identical to SP|P42763... 32 0.42 At5g50915.2 68418.m06314 basic helix-loop-helix (bHLH) family pr... 31 0.56 At5g50915.1 68418.m06313 basic helix-loop-helix (bHLH) family pr... 31 0.56 At4g37850.1 68417.m05354 basic helix-loop-helix (bHLH) family pr... 31 0.73 At4g36930.1 68417.m05235 basic helix-loop-helix (bHLH) protein S... 31 0.73 At4g30980.1 68417.m04397 basic helix-loop-helix (bHLH) family pr... 31 0.97 At3g29075.1 68416.m03637 glycine-rich protein 31 0.97 At1g03040.1 68414.m00276 basic helix-loop-helix (bHLH) family pr... 31 0.97 At3g28770.1 68416.m03591 expressed protein 30 1.3 At2g44200.1 68415.m05500 expressed protein 30 1.3 At2g24260.1 68415.m02898 basic helix-loop-helix (bHLH) family pr... 30 1.7 At4g02590.1 68417.m00353 basic helix-loop-helix (bHLH) family pr... 29 2.2 At2g22750.1 68415.m02697 basic helix-loop-helix (bHLH) family pr... 29 2.2 At1g22450.1 68414.m02806 cytochrome c oxidase subunit 6b, putati... 29 2.2 At5g16130.1 68418.m01884 40S ribosomal protein S7 (RPS7C) 40S ri... 29 3.0 At2g03810.2 68415.m00341 18S pre-ribosomal assembly protein gar2... 29 3.0 At2g03810.1 68415.m00340 18S pre-ribosomal assembly protein gar2... 29 3.0 At1g01260.1 68414.m00043 basic helix-loop-helix (bHLH) family pr... 29 3.0 At5g63720.1 68418.m07998 hypothetical protein 29 3.9 At4g12780.1 68417.m02005 auxilin-related low similarity to SP|Q2... 29 3.9 At3g30725.1 68416.m03909 expressed protein ; expression supporte... 29 3.9 At2g40200.1 68415.m04943 basic helix-loop-helix (bHLH) family pr... 29 3.9 At2g21940.2 68415.m02607 shikimate kinase, putative similar to s... 28 5.2 At2g21940.1 68415.m02606 shikimate kinase, putative similar to s... 28 5.2 At1g20920.1 68414.m02619 DEAD box RNA helicase, putative similar... 28 5.2 At5g16500.1 68418.m01928 protein kinase family protein contains ... 28 6.8 At3g21480.1 68416.m02710 transcription activation domain-interac... 28 6.8 At5g41090.1 68418.m04995 no apical meristem (NAM) family protein... 27 9.0 At4g38600.2 68417.m05463 HECT-domain-containing protein / ubiqui... 27 9.0 At4g38600.1 68417.m05464 HECT-domain-containing protein / ubiqui... 27 9.0 At3g14010.1 68416.m01769 hydroxyproline-rich glycoprotein family... 27 9.0 At2g27690.1 68415.m03355 cytochrome P450, putative similar to Cy... 27 9.0 At2g20310.1 68415.m02372 expressed protein 27 9.0 At2g06210.2 68415.m00683 phosphoprotein-related low similarity t... 27 9.0 At2g06210.1 68415.m00684 phosphoprotein-related low similarity t... 27 9.0 At1g50410.1 68414.m05650 SNF2 domain-containing protein / helica... 27 9.0 At1g42990.1 68414.m04949 bZIP transcription factor family protei... 27 9.0 At1g27740.1 68414.m03390 basic helix-loop-helix (bHLH) family pr... 27 9.0 At1g14687.1 68414.m01755 zinc finger homeobox family protein / Z... 27 9.0 >At4g00050.1 68417.m00005 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 399 Score = 43.2 bits (97), Expect = 2e-04 Identities = 25/72 (34%), Positives = 37/72 (51%), Gaps = 1/72 (1%) Frame = +2 Query: 299 GSSGSIQNIHQTPSSSNQNTEDEDDSGDNKASALSFKERRREA-HTQAEQKRRDAIKKGY 475 GS + + H + S EDE++ S++S K R A H Q+E+KRRD I + Sbjct: 174 GSHDNTIDDHDSVCHSRPQMEDEEEKKAGGKSSVSTKRSRAAAIHNQSERKRRDKINQRM 233 Query: 476 DSLQDLVPTCQR 511 +LQ LVP + Sbjct: 234 KTLQKLVPNSSK 245 >At3g23690.1 68416.m02979 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 371 Score = 41.9 bits (94), Expect = 4e-04 Identities = 29/84 (34%), Positives = 39/84 (46%), Gaps = 12/84 (14%) Frame = +2 Query: 299 GSSGSIQNIHQTPSSSNQNTEDEDDSGDNKASA---------LSFKERRREA---HTQAE 442 GS G ++ SS E D GDNK A + + RR +A H+ AE Sbjct: 147 GSKGGKRSKQDVAGSSKNGVEKCDSKGDNKDDAKPPEAPKDYIHVRARRGQATDSHSLAE 206 Query: 443 QKRRDAIKKGYDSLQDLVPTCQRV 514 + RR+ I + LQDLVP C R+ Sbjct: 207 RARREKISERMTLLQDLVPGCNRI 230 >At1g26260.2 68414.m03204 basic helix-loop-helix (bHLH) family protein similar to bHLH transcription factor GBOF-1 GI:5923912 from [Tulipa gesneriana] Length = 390 Score = 41.5 bits (93), Expect = 5e-04 Identities = 25/70 (35%), Positives = 37/70 (52%), Gaps = 4/70 (5%) Frame = +2 Query: 317 QNIHQTPSSSNQNTEDEDDSGDN-KASALSFKERRREA---HTQAEQKRRDAIKKGYDSL 484 Q Q+P+S+ T E D+ K + + RR +A H+ AE+ RR+ I + L Sbjct: 193 QKDEQSPTSNANKTNSEKQPSDSLKDGYIHMRARRGQATNSHSLAERVRREKISERMKFL 252 Query: 485 QDLVPTCQRV 514 QDLVP C +V Sbjct: 253 QDLVPGCDKV 262 >At1g26260.1 68414.m03203 basic helix-loop-helix (bHLH) family protein similar to bHLH transcription factor GBOF-1 GI:5923912 from [Tulipa gesneriana] Length = 390 Score = 41.5 bits (93), Expect = 5e-04 Identities = 25/70 (35%), Positives = 37/70 (52%), Gaps = 4/70 (5%) Frame = +2 Query: 317 QNIHQTPSSSNQNTEDEDDSGDN-KASALSFKERRREA---HTQAEQKRRDAIKKGYDSL 484 Q Q+P+S+ T E D+ K + + RR +A H+ AE+ RR+ I + L Sbjct: 193 QKDEQSPTSNANKTNSEKQPSDSLKDGYIHMRARRGQATNSHSLAERVRREKISERMKFL 252 Query: 485 QDLVPTCQRV 514 QDLVP C +V Sbjct: 253 QDLVPGCDKV 262 >At1g09530.2 68414.m01069 phytochrome interacting factor 3 (PIF3) identical to phytochrome interacting factor 3 (PIF3) GI:3929585 from [Arabidopsis thaliana] Length = 524 Score = 41.5 bits (93), Expect = 5e-04 Identities = 26/83 (31%), Positives = 43/83 (51%), Gaps = 8/83 (9%) Frame = +2 Query: 290 PRCGSSGSIQNIHQTPSSSNQNTED-EDDSGDNKASAL-------SFKERRREAHTQAEQ 445 P S S++ H + ++ED E++SGD + A S + R E H +E+ Sbjct: 294 PSESPSLSLKRKHSNIQDIDCHSEDVEEESGDGRKEAGPSRTGLGSKRSRSAEVHNLSER 353 Query: 446 KRRDAIKKGYDSLQDLVPTCQRV 514 +RRD I + +LQ+L+P C +V Sbjct: 354 RRRDRINEKMRALQELIPNCNKV 376 >At1g09530.1 68414.m01068 phytochrome interacting factor 3 (PIF3) identical to phytochrome interacting factor 3 (PIF3) GI:3929585 from [Arabidopsis thaliana] Length = 524 Score = 41.5 bits (93), Expect = 5e-04 Identities = 26/83 (31%), Positives = 43/83 (51%), Gaps = 8/83 (9%) Frame = +2 Query: 290 PRCGSSGSIQNIHQTPSSSNQNTED-EDDSGDNKASAL-------SFKERRREAHTQAEQ 445 P S S++ H + ++ED E++SGD + A S + R E H +E+ Sbjct: 294 PSESPSLSLKRKHSNIQDIDCHSEDVEEESGDGRKEAGPSRTGLGSKRSRSAEVHNLSER 353 Query: 446 KRRDAIKKGYDSLQDLVPTCQRV 514 +RRD I + +LQ+L+P C +V Sbjct: 354 RRRDRINEKMRALQELIPNCNKV 376 >At2g18300.2 68415.m02134 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain ;supported by cDNA gi|20127067|gb|AF488597.1| Length = 337 Score = 40.7 bits (91), Expect = 0.001 Identities = 24/69 (34%), Positives = 38/69 (55%), Gaps = 4/69 (5%) Frame = +2 Query: 320 NIHQTPSSSNQNTEDEDDSGDN-KASALSFKERRREA---HTQAEQKRRDAIKKGYDSLQ 487 N+ T +SS+ + E + +N K + + RR +A H+ AE+ RR+ I K LQ Sbjct: 156 NMGNTEASSDTSKETSKGASENQKLDYIHVRARRGQATDRHSLAERARREKISKKMKYLQ 215 Query: 488 DLVPTCQRV 514 D+VP C +V Sbjct: 216 DIVPGCNKV 224 >At2g18300.1 68415.m02133 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain ;supported by cDNA gi|20127067|gb|AF488597.1| Length = 335 Score = 40.7 bits (91), Expect = 0.001 Identities = 24/69 (34%), Positives = 38/69 (55%), Gaps = 4/69 (5%) Frame = +2 Query: 320 NIHQTPSSSNQNTEDEDDSGDN-KASALSFKERRREA---HTQAEQKRRDAIKKGYDSLQ 487 N+ T +SS+ + E + +N K + + RR +A H+ AE+ RR+ I K LQ Sbjct: 156 NMGNTEASSDTSKETSKGASENQKLDYIHVRARRGQATDRHSLAERARREKISKKMKYLQ 215 Query: 488 DLVPTCQRV 514 D+VP C +V Sbjct: 216 DIVPGCNKV 224 >At3g59060.2 68416.m06584 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 444 Score = 40.3 bits (90), Expect = 0.001 Identities = 21/55 (38%), Positives = 31/55 (56%), Gaps = 3/55 (5%) Frame = +2 Query: 356 TEDEDDSGDNKASALSFKERRR---EAHTQAEQKRRDAIKKGYDSLQDLVPTCQR 511 T +D + NK+S S RR E H +E++RRD I + +LQ+L+P C R Sbjct: 234 TSTDDQTMGNKSSQRSGSTRRSRAAEVHNLSERRRRDRINERMKALQELIPHCSR 288 >At3g59060.1 68416.m06583 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 442 Score = 40.3 bits (90), Expect = 0.001 Identities = 21/55 (38%), Positives = 31/55 (56%), Gaps = 3/55 (5%) Frame = +2 Query: 356 TEDEDDSGDNKASALSFKERRR---EAHTQAEQKRRDAIKKGYDSLQDLVPTCQR 511 T +D + NK+S S RR E H +E++RRD I + +LQ+L+P C R Sbjct: 234 TSTDDQTMGNKSSQRSGSTRRSRAAEVHNLSERRRRDRINERMKALQELIPHCSR 288 >At2g46970.1 68415.m05867 basic helix-loop-helix (bHLH) protein, putative similar to PIF3 like basic Helix Loop Helix protein (PIL1) [Arabidopsis thaliana] GI:22535492; contains Myc-type, 'helix-loop-helix' dimerization domain signature, PROSITE:PS00038 Length = 416 Score = 40.3 bits (90), Expect = 0.001 Identities = 23/71 (32%), Positives = 35/71 (49%), Gaps = 3/71 (4%) Frame = +2 Query: 308 GSIQNIHQTPSSSNQNTEDEDDSGDNKASA---LSFKERRREAHTQAEQKRRDAIKKGYD 478 G I+ T S+N + E +D A ++ ++R E H E+KRRD K Sbjct: 191 GDIEEEESTYLSNNSDDESDDAKTQVHARTRKPVTKRKRSTEVHKLYERKRRDEFNKKMR 250 Query: 479 SLQDLVPTCQR 511 +LQDL+P C + Sbjct: 251 ALQDLLPNCYK 261 >At1g73830.1 68414.m08548 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 261 Score = 39.1 bits (87), Expect = 0.003 Identities = 26/89 (29%), Positives = 45/89 (50%), Gaps = 7/89 (7%) Frame = +2 Query: 320 NIHQTPSSSNQNTEDEDDSGDNKASALSFKERRREA---HTQAEQKRRDAIKKGYDSLQD 490 NI +SS + ++ + + + + RR +A H+ AE+ RR I + LQD Sbjct: 119 NISTKNNSSRRGKRSKNREEEKEREVVHVRARRGQATDSHSIAERVRRGKINERLKCLQD 178 Query: 491 LVPTCQRVMRLATNQAKL----QSFRNQL 565 +VP C + M +AT ++ QS +NQ+ Sbjct: 179 IVPGCYKTMGMATMLDEIINYVQSLQNQV 207 >At4g28800.1 68417.m04118 bHLH family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 478 Score = 38.7 bits (86), Expect = 0.004 Identities = 19/62 (30%), Positives = 35/62 (56%), Gaps = 2/62 (3%) Frame = +2 Query: 335 PSSSNQNTEDEDDSGDNKASALSFKERRR--EAHTQAEQKRRDAIKKGYDSLQDLVPTCQ 508 P++ ++ E+ G +A + ++R R E H AE++RR+ I + +LQ L+P C Sbjct: 227 PATESKLKAREETHGTEEARGSTSRKRSRTAEMHNLAERRRREKINEKMKTLQQLIPRCN 286 Query: 509 RV 514 +V Sbjct: 287 KV 288 >At4g27120.2 68417.m03898 expressed protein Length = 298 Score = 38.7 bits (86), Expect = 0.004 Identities = 20/64 (31%), Positives = 38/64 (59%) Frame = +2 Query: 299 GSSGSIQNIHQTPSSSNQNTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDAIKKGYD 478 G+S S N+ + S S EDED++G +A A KE++R+ +A+++ +A ++ + Sbjct: 64 GASSSTSNVQENGSGSED--EDEDEAGGTQARASKKKEKKRQ-EREAQRQAEEATRESRN 120 Query: 479 SLQD 490 + QD Sbjct: 121 TKQD 124 >At4g27120.1 68417.m03897 expressed protein Length = 298 Score = 38.7 bits (86), Expect = 0.004 Identities = 20/64 (31%), Positives = 38/64 (59%) Frame = +2 Query: 299 GSSGSIQNIHQTPSSSNQNTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDAIKKGYD 478 G+S S N+ + S S EDED++G +A A KE++R+ +A+++ +A ++ + Sbjct: 64 GASSSTSNVQENGSGSED--EDEDEAGGTQARASKKKEKKRQ-EREAQRQAEEATRESRN 120 Query: 479 SLQD 490 + QD Sbjct: 121 TKQD 124 >At1g18400.1 68414.m02298 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 260 Score = 38.3 bits (85), Expect = 0.005 Identities = 22/73 (30%), Positives = 39/73 (53%), Gaps = 4/73 (5%) Frame = +2 Query: 359 EDEDDSGDNKASALSFKERRREAHTQAEQKRRDAIKKGYDSLQDLVPTCQRVMRLATNQA 538 E+ED+ + + + ++H+ AE+ RR I + LQD+VP C + M +AT Sbjct: 133 EEEDEKEREVVHVRARRGQATDSHSLAERVRRGKINERLRCLQDMVPGCYKAMGMATMLD 192 Query: 539 KL----QSFRNQL 565 ++ QS +NQ+ Sbjct: 193 EIINYVQSLQNQV 205 >At2g20180.2 68415.m02360 basic helix-loop-helix (bHLH) family protein contains Pfam domain, PF00010: Helix-loop-helix DNA-binding domain Length = 478 Score = 37.5 bits (83), Expect = 0.008 Identities = 17/59 (28%), Positives = 33/59 (55%), Gaps = 1/59 (1%) Frame = +2 Query: 338 SSSNQNTEDEDDSGDNKASALSFKERRR-EAHTQAEQKRRDAIKKGYDSLQDLVPTCQR 511 +++++ +++ + S S K R E H +E+KRRD I + +LQ+L+P C + Sbjct: 258 TTTDETESRSEETKQARVSTTSTKRSRAAEVHNLSERKRRDRINERMKALQELIPRCNK 316 >At2g20180.1 68415.m02359 basic helix-loop-helix (bHLH) family protein contains Pfam domain, PF00010: Helix-loop-helix DNA-binding domain Length = 407 Score = 37.5 bits (83), Expect = 0.008 Identities = 17/59 (28%), Positives = 33/59 (55%), Gaps = 1/59 (1%) Frame = +2 Query: 338 SSSNQNTEDEDDSGDNKASALSFKERRR-EAHTQAEQKRRDAIKKGYDSLQDLVPTCQR 511 +++++ +++ + S S K R E H +E+KRRD I + +LQ+L+P C + Sbjct: 187 TTTDETESRSEETKQARVSTTSTKRSRAAEVHNLSERKRRDRINERMKALQELIPRCNK 245 >At4g36540.2 68417.m05189 basic helix-loop-helix (bHLH) family protein contains Pfam domain, PF00010: Helix-loop-helix DNA-binding domain Length = 302 Score = 37.1 bits (82), Expect = 0.011 Identities = 23/61 (37%), Positives = 32/61 (52%), Gaps = 3/61 (4%) Frame = +2 Query: 341 SSNQNTEDEDDSGDNKASALSFKERRREA---HTQAEQKRRDAIKKGYDSLQDLVPTCQR 511 S+ NTE + K + + RR EA H+ AE+ RR+ I K LQD+VP C + Sbjct: 122 SNMSNTETSSEI--QKPDYIHVRARRGEATDRHSLAERARREKISKKMKCLQDIVPGCNK 179 Query: 512 V 514 V Sbjct: 180 V 180 >At4g36540.1 68417.m05188 basic helix-loop-helix (bHLH) family protein contains Pfam domain, PF00010: Helix-loop-helix DNA-binding domain Length = 304 Score = 37.1 bits (82), Expect = 0.011 Identities = 23/61 (37%), Positives = 32/61 (52%), Gaps = 3/61 (4%) Frame = +2 Query: 341 SSNQNTEDEDDSGDNKASALSFKERRREA---HTQAEQKRRDAIKKGYDSLQDLVPTCQR 511 S+ NTE + K + + RR EA H+ AE+ RR+ I K LQD+VP C + Sbjct: 122 SNMSNTETSSEI--QKPDYIHVRARRGEATDRHSLAERARREKISKKMKCLQDIVPGCNK 179 Query: 512 V 514 V Sbjct: 180 V 180 >At3g07340.1 68416.m00875 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 456 Score = 37.1 bits (82), Expect = 0.011 Identities = 34/125 (27%), Positives = 58/125 (46%), Gaps = 13/125 (10%) Frame = +2 Query: 311 SIQNIHQTPSSSNQNTEDEDDSGDNKASALSFKE------RRREA---HTQAEQKRRDAI 463 S + I + S + + +++GD S +K+ RR +A H+ AE+ RR+ I Sbjct: 221 SSKEIEEKEDSDPKRCKKSEENGDKTKSIDPYKDYIHVRARRGQATDSHSLAERVRREKI 280 Query: 464 KKGYDSLQDLVPTCQRVMRLATNQAKL----QSFRNQLTTSSICYNSVVDREEERMHCVK 631 + LQDLVP C +V A ++ QS + Q+ S+ +SV R + M + Sbjct: 281 SERMKLLQDLVPGCNKVTGKALMLDEIINYVQSLQRQVEFLSMKLSSVNTRLDFNMDALL 340 Query: 632 MLSLF 646 +F Sbjct: 341 SKDIF 345 >At2g43010.2 68415.m05338 phytochrome-interacting factor 4 (PIF4) / basic helix-loop-helix protein 9 (bHLH9) / short under red-light 2 (SRL2) identical to SP|Q8W2F3 Phytochrome-interacting factor 4 (Basic helix-loop-helix protein 9) (bHLH9) (Short under red-light 2) {Arabidopsis thaliana}; supporting cDNA gi|18026965|gb|AF251694.1|AF251694 Length = 428 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/43 (34%), Positives = 26/43 (60%) Frame = +2 Query: 383 NKASALSFKERRREAHTQAEQKRRDAIKKGYDSLQDLVPTCQR 511 N+ S + + R E H +E++RRD I + +LQ+L+P C + Sbjct: 247 NQRSGSNRRSRAAEVHNLSERRRRDRINERMKALQELIPHCSK 289 >At2g43010.1 68415.m05337 phytochrome-interacting factor 4 (PIF4) / basic helix-loop-helix protein 9 (bHLH9) / short under red-light 2 (SRL2) identical to SP|Q8W2F3 Phytochrome-interacting factor 4 (Basic helix-loop-helix protein 9) (bHLH9) (Short under red-light 2) {Arabidopsis thaliana}; supporting cDNA gi|18026965|gb|AF251694.1|AF251694 Length = 430 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/43 (34%), Positives = 26/43 (60%) Frame = +2 Query: 383 NKASALSFKERRREAHTQAEQKRRDAIKKGYDSLQDLVPTCQR 511 N+ S + + R E H +E++RRD I + +LQ+L+P C + Sbjct: 247 NQRSGSNRRSRAAEVHNLSERRRRDRINERMKALQELIPHCSK 289 >At1g68920.2 68414.m07888 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 485 Score = 35.9 bits (79), Expect = 0.026 Identities = 26/74 (35%), Positives = 38/74 (51%), Gaps = 8/74 (10%) Frame = +2 Query: 317 QNIHQTPSS----SNQNTEDEDDSGDN-KASALSFKERRREA---HTQAEQKRRDAIKKG 472 +N Q+P+S SN + S D K + + RR +A H+ AE+ RR+ I + Sbjct: 268 RNDEQSPNSPGKKSNSGKQQGKQSSDPPKDGYIHVRARRGQATNSHSLAERVRREKISER 327 Query: 473 YDSLQDLVPTCQRV 514 LQDLVP C +V Sbjct: 328 MKFLQDLVPGCNKV 341 >At1g68920.1 68414.m07887 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 486 Score = 35.9 bits (79), Expect = 0.026 Identities = 26/74 (35%), Positives = 38/74 (51%), Gaps = 8/74 (10%) Frame = +2 Query: 317 QNIHQTPSS----SNQNTEDEDDSGDN-KASALSFKERRREA---HTQAEQKRRDAIKKG 472 +N Q+P+S SN + S D K + + RR +A H+ AE+ RR+ I + Sbjct: 269 RNDEQSPNSPGKKSNSGKQQGKQSSDPPKDGYIHVRARRGQATNSHSLAERVRREKISER 328 Query: 473 YDSLQDLVPTCQRV 514 LQDLVP C +V Sbjct: 329 MKFLQDLVPGCNKV 342 >At5g61270.1 68418.m07689 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 366 Score = 35.5 bits (78), Expect = 0.034 Identities = 18/63 (28%), Positives = 35/63 (55%), Gaps = 1/63 (1%) Frame = +2 Query: 341 SSNQNTEDEDDSGDNKASALSFKERRREA-HTQAEQKRRDAIKKGYDSLQDLVPTCQRVM 517 S Q+TE ++ +A + + R A H ++E++RRD I + +LQ L+PT + Sbjct: 141 SETQDTEGDEQETRGEAGRSNGRRGRAAAIHNESERRRRDRINQRMRTLQKLLPTASKAD 200 Query: 518 RLA 526 +++ Sbjct: 201 KVS 203 >At1g10120.1 68414.m01141 basic helix-loop-helix (bHLH) family protein contains Pfam domain, PF00010: Helix-loop-helix DNA-binding domain Length = 301 Score = 35.5 bits (78), Expect = 0.034 Identities = 22/78 (28%), Positives = 36/78 (46%), Gaps = 3/78 (3%) Frame = +2 Query: 290 PRCGSSGSIQNIHQTPSSSNQNTEDEDDSGDNKASALSFKERRREA---HTQAEQKRRDA 460 P+ G+ S + S N E K + + + RR +A H+ AE+ RR+ Sbjct: 103 PQRGNDQSQKKHKNDQSKETVNKESSQSEEAPKENYIHMRARRGQATNSHSLAERVRREK 162 Query: 461 IKKGYDSLQDLVPTCQRV 514 I + LQ+LVP C ++ Sbjct: 163 ISERMRLLQELVPGCNKI 180 >At4g34530.1 68417.m04907 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 335 Score = 34.7 bits (76), Expect = 0.060 Identities = 24/78 (30%), Positives = 38/78 (48%), Gaps = 6/78 (7%) Frame = +2 Query: 299 GSSGSIQNI-HQTPSSSNQNTEDEDDSGDN--KASALSFKERRREA---HTQAEQKRRDA 460 GS+ SI+ + H+ N + D K + + RR +A H+ AE+ RR+ Sbjct: 134 GSTKSIKKMKHKAKKEENNFSNDSSKVTKELEKTDYIHVRARRGQATDSHSIAERVRREK 193 Query: 461 IKKGYDSLQDLVPTCQRV 514 I + LQDLVP C ++ Sbjct: 194 ISERMKFLQDLVPGCDKI 211 >At1g25330.1 68414.m03143 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 223 Score = 34.7 bits (76), Expect = 0.060 Identities = 15/35 (42%), Positives = 23/35 (65%) Frame = +2 Query: 422 EAHTQAEQKRRDAIKKGYDSLQDLVPTCQRVMRLA 526 ++H+ AE+ RR+ I + LQDLVP C + M +A Sbjct: 113 DSHSLAERVRREKINERLKCLQDLVPGCYKAMGMA 147 >At3g57800.2 68416.m06443 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain; supported by full-length cDNA gi:20127059 Length = 379 Score = 34.3 bits (75), Expect = 0.079 Identities = 23/86 (26%), Positives = 41/86 (47%), Gaps = 3/86 (3%) Frame = +2 Query: 278 PNMYPRCGSSGSIQNIHQTPSSSNQNTEDEDDSGDNKASALSFKERRREA---HTQAEQK 448 PN R G + ++ + N+++E+ + K + + RR +A H+ AE+ Sbjct: 167 PNQNNRNGKRKDFEKKGKSSTKKNKSSEENE-----KLPYVHVRARRGQATDSHSLAERA 221 Query: 449 RRDAIKKGYDSLQDLVPTCQRVMRLA 526 RR+ I LQ+LVP C ++ A Sbjct: 222 RREKINARMKLLQELVPGCDKIQGTA 247 >At1g69010.1 68414.m07896 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 311 Score = 33.9 bits (74), Expect = 0.10 Identities = 18/59 (30%), Positives = 32/59 (54%) Frame = +2 Query: 335 PSSSNQNTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDAIKKGYDSLQDLVPTCQR 511 PSS+ + D ++KASA+ R H+ EQ+RR I + + L++L+P ++ Sbjct: 25 PSSNTTVHSNRDSKENDKASAI------RSKHSVTEQRRRSKINERFQILRELIPNSEQ 77 >At1g59640.2 68414.m06708 basic helix-loop-helix (bHLH) family protein Length = 343 Score = 33.9 bits (74), Expect = 0.10 Identities = 20/62 (32%), Positives = 31/62 (50%), Gaps = 3/62 (4%) Frame = +2 Query: 341 SSNQNTEDEDDSGDNKASALSFKERRREA---HTQAEQKRRDAIKKGYDSLQDLVPTCQR 511 S TE + + + + RR +A H+ AE+ RR+ I + LQDLVP C + Sbjct: 115 SLGTETEQKKQQMEPTKDYIHVRARRGQATDSHSLAERARREKISERMKILQDLVPGCNK 174 Query: 512 VM 517 V+ Sbjct: 175 VI 176 >At1g59640.1 68414.m06707 basic helix-loop-helix (bHLH) family protein Length = 264 Score = 33.9 bits (74), Expect = 0.10 Identities = 20/62 (32%), Positives = 31/62 (50%), Gaps = 3/62 (4%) Frame = +2 Query: 341 SSNQNTEDEDDSGDNKASALSFKERRREA---HTQAEQKRRDAIKKGYDSLQDLVPTCQR 511 S TE + + + + RR +A H+ AE+ RR+ I + LQDLVP C + Sbjct: 115 SLGTETEQKKQQMEPTKDYIHVRARRGQATDSHSLAERARREKISERMKILQDLVPGCNK 174 Query: 512 VM 517 V+ Sbjct: 175 VI 176 >At4g28790.2 68417.m04116 basic helix-loop-helix (bHLH) family protein contains Pfam domain, PF00010: Helix-loop-helix DNA-binding domain Length = 340 Score = 33.5 bits (73), Expect = 0.14 Identities = 20/58 (34%), Positives = 30/58 (51%) Frame = +2 Query: 347 NQNTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDAIKKGYDSLQDLVPTCQRVMR 520 NQ TE+ DS +K S R H +E++RR I + +LQ+L+P C + R Sbjct: 261 NQGTEEARDSTSSKRS------RAAIMHKLSERRRRQKINEMMKALQELLPRCTKTDR 312 >At4g28790.1 68417.m04117 basic helix-loop-helix (bHLH) family protein contains Pfam domain, PF00010: Helix-loop-helix DNA-binding domain Length = 413 Score = 33.5 bits (73), Expect = 0.14 Identities = 20/58 (34%), Positives = 30/58 (51%) Frame = +2 Query: 347 NQNTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDAIKKGYDSLQDLVPTCQRVMR 520 NQ TE+ DS +K S R H +E++RR I + +LQ+L+P C + R Sbjct: 261 NQGTEEARDSTSSKRS------RAAIMHKLSERRRRQKINEMMKALQELLPRCTKTDR 312 >At5g48560.1 68418.m06005 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 498 Score = 32.7 bits (71), Expect = 0.24 Identities = 22/64 (34%), Positives = 35/64 (54%), Gaps = 4/64 (6%) Frame = +2 Query: 422 EAHTQAEQKRRDAIKKGYDSLQDLVPTCQRVMRLATNQAKL----QSFRNQLTTSSICYN 589 ++H+ AE+ RR+ I + LQDLVP C +V A ++ QS + Q+ S+ + Sbjct: 310 DSHSLAERVRREKIGERMKLLQDLVPGCNKVTGKALMLDEIINYVQSLQRQVEFLSMKLS 369 Query: 590 SVVD 601 SV D Sbjct: 370 SVND 373 >At3g57800.1 68416.m06442 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain; supported by full-length cDNA gi:20127059 Length = 426 Score = 32.7 bits (71), Expect = 0.24 Identities = 22/81 (27%), Positives = 39/81 (48%), Gaps = 3/81 (3%) Frame = +2 Query: 278 PNMYPRCGSSGSIQNIHQTPSSSNQNTEDEDDSGDNKASALSFKERRREA---HTQAEQK 448 PN R G + ++ + N+++E+ + K + + RR +A H+ AE+ Sbjct: 167 PNQNNRNGKRKDFEKKGKSSTKKNKSSEENE-----KLPYVHVRARRGQATDSHSLAERA 221 Query: 449 RRDAIKKGYDSLQDLVPTCQR 511 RR+ I LQ+LVP C + Sbjct: 222 RREKINARMKLLQELVPGCDK 242 >At2g42300.1 68415.m05236 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 327 Score = 32.7 bits (71), Expect = 0.24 Identities = 23/78 (29%), Positives = 38/78 (48%), Gaps = 3/78 (3%) Frame = +2 Query: 302 SSGSIQNIHQTPSSSNQNTEDEDDSGDNKASALSFKERRREA---HTQAEQKRRDAIKKG 472 SSG + + SS + + +S +K + + RR +A H+ AE+ RR+ I Sbjct: 153 SSGKRKEREKKVKSSTKKNKSSVES--DKLPYVHVRARRGQATDNHSLAERARREKINAR 210 Query: 473 YDSLQDLVPTCQRVMRLA 526 LQ+LVP C ++ A Sbjct: 211 MKLLQELVPGCDKIQGTA 228 >At5g62610.1 68418.m07857 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 281 Score = 32.3 bits (70), Expect = 0.32 Identities = 11/32 (34%), Positives = 22/32 (68%) Frame = +2 Query: 422 EAHTQAEQKRRDAIKKGYDSLQDLVPTCQRVM 517 + H+ AE+ RR+ I + +LQD++P C +++ Sbjct: 162 DRHSLAERARREKISEKMTALQDIIPGCNKII 193 >At5g38860.1 68418.m04700 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 298 Score = 31.9 bits (69), Expect = 0.42 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = +2 Query: 419 REAHTQAEQKRRDAIKKGYDSLQDLVPTCQ 508 R H++ EQ+RR I + + SL D++P Q Sbjct: 35 RSKHSETEQRRRSKINERFQSLMDIIPQNQ 64 >At3g19510.1 68416.m02472 homeobox protein (HAT 3.1) identical to homeotic protein HAT 3.1 (GI:11994474) [Arabidopsis thaliana] Length = 723 Score = 31.9 bits (69), Expect = 0.42 Identities = 16/54 (29%), Positives = 25/54 (46%) Frame = +2 Query: 335 PSSSNQNTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDAIKKGYDSLQDLV 496 P N N DED S DN+ S T A + ++ K+G D ++D++ Sbjct: 377 PDCLNDNENDEDGSDDNEESENEDGSSDETEFTSASDEMIESFKEGKDIMKDVM 430 >At1g76180.1 68414.m08846 dehydrin (ERD14) identical to SP|P42763 Dehydrin ERD14 {Arabidopsis thaliana} Length = 185 Score = 31.9 bits (69), Expect = 0.42 Identities = 17/71 (23%), Positives = 39/71 (54%), Gaps = 1/71 (1%) Frame = +2 Query: 290 PRCGSSGSIQNIHQTPSSSNQNTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDAIKK 469 P ++ +H++ SSS+ ++E+E G+ + K+ +++ T+ E K + KK Sbjct: 63 PEVKHESLLEKLHRSDSSSSSSSEEEGSDGEKRKK----KKEKKKPTTEVEVKEEE--KK 116 Query: 470 GY-DSLQDLVP 499 G+ + L++ +P Sbjct: 117 GFMEKLKEKLP 127 >At5g50915.2 68418.m06314 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 286 Score = 31.5 bits (68), Expect = 0.56 Identities = 13/31 (41%), Positives = 22/31 (70%) Frame = +2 Query: 422 EAHTQAEQKRRDAIKKGYDSLQDLVPTCQRV 514 ++H+ AE+ RR+ I + +LQ+LVP C +V Sbjct: 145 DSHSLAERVRREKISERMRTLQNLVPGCDKV 175 >At5g50915.1 68418.m06313 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 286 Score = 31.5 bits (68), Expect = 0.56 Identities = 13/31 (41%), Positives = 22/31 (70%) Frame = +2 Query: 422 EAHTQAEQKRRDAIKKGYDSLQDLVPTCQRV 514 ++H+ AE+ RR+ I + +LQ+LVP C +V Sbjct: 145 DSHSLAERVRREKISERMRTLQNLVPGCDKV 175 >At4g37850.1 68417.m05354 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 328 Score = 31.1 bits (67), Expect = 0.73 Identities = 14/56 (25%), Positives = 31/56 (55%) Frame = +2 Query: 347 NQNTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDAIKKGYDSLQDLVPTCQRV 514 +Q +++ + G +A S + + H AE+KRR+ + + + +L LVP +++ Sbjct: 126 HQKSDEFNRKGTKRAQPFSRNQSNAQDHIIAERKRREKLTQRFVALSALVPGLKKM 181 >At4g36930.1 68417.m05235 basic helix-loop-helix (bHLH) protein SPATULA (SPT) identical to SPATULA (SPT) GI:11245493 from [Arabidopsis thaliana] Length = 373 Score = 31.1 bits (67), Expect = 0.73 Identities = 21/74 (28%), Positives = 36/74 (48%), Gaps = 3/74 (4%) Frame = +2 Query: 299 GSSGSIQNIHQTPSSSN-QNTEDEDDSGDNKASALSFKERRR--EAHTQAEQKRRDAIKK 469 G+SG+ + + S + DE S + S+ S +R R E H +E++RR I + Sbjct: 156 GASGNETDEYDCESEEGGEAVVDEAPSSKSGPSSRSSSKRCRAAEVHNLSEKRRRSRINE 215 Query: 470 GYDSLQDLVPTCQR 511 +LQ L+P + Sbjct: 216 KMKALQSLIPNSNK 229 >At4g30980.1 68417.m04397 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 310 Score = 30.7 bits (66), Expect = 0.97 Identities = 19/67 (28%), Positives = 33/67 (49%) Frame = +2 Query: 299 GSSGSIQNIHQTPSSSNQNTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDAIKKGYD 478 GS G Q Q+ ++++ T K + + + + H+ AE+ RR+ I + Sbjct: 100 GSGGQTQT--QSQATASATTGGATAQPQTKPKVRARRGQATDPHSIAERLRRERIAERMK 157 Query: 479 SLQDLVP 499 SLQ+LVP Sbjct: 158 SLQELVP 164 >At3g29075.1 68416.m03637 glycine-rich protein Length = 294 Score = 30.7 bits (66), Expect = 0.97 Identities = 17/64 (26%), Positives = 31/64 (48%) Frame = +2 Query: 299 GSSGSIQNIHQTPSSSNQNTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDAIKKGYD 478 G G I++ + PS ED+ D G K S + + ++ + ++K++D K G + Sbjct: 121 GYGGRIESDYVKPSYGGH--EDDGDDGHKKHSGKDYDDGDEKSKKKEKEKKKDKKKDGNN 178 Query: 479 SLQD 490 S D Sbjct: 179 SEDD 182 >At1g03040.1 68414.m00276 basic helix-loop-helix (bHLH) family protein component of the pyruvate dehydrogenase complex E3, contains PF|00010 helix-loop-helix DNA-binding domain. ESTs gb|T45640 and gb|T22783 come from this gene Length = 302 Score = 30.7 bits (66), Expect = 0.97 Identities = 15/35 (42%), Positives = 22/35 (62%) Frame = +2 Query: 422 EAHTQAEQKRRDAIKKGYDSLQDLVPTCQRVMRLA 526 + H+ AE+ RR+ I + SLQ+LVPT + R A Sbjct: 153 DPHSIAERLRRERIAERIRSLQELVPTVNKTDRAA 187 >At3g28770.1 68416.m03591 expressed protein Length = 2081 Score = 30.3 bits (65), Expect = 1.3 Identities = 10/54 (18%), Positives = 31/54 (57%) Frame = +2 Query: 329 QTPSSSNQNTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDAIKKGYDSLQD 490 ++ + ++ ED+ + DNK+ ++ ++ H +++ ++++ KK + L+D Sbjct: 1072 ESENHKSKKKEDKKEHEDNKSMKKEEDKKEKKKHEESKSRKKEEDKKDMEKLED 1125 >At2g44200.1 68415.m05500 expressed protein Length = 493 Score = 30.3 bits (65), Expect = 1.3 Identities = 13/47 (27%), Positives = 24/47 (51%) Frame = +2 Query: 326 HQTPSSSNQNTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDAIK 466 HQ SSS Q ++ E+DSG+ S ++ H + ++ R ++ Sbjct: 191 HQKQSSSRQRSDSEEDSGEENNGRKSHHQKTSGTHDRHYERPRSDLE 237 >At2g24260.1 68415.m02898 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 350 Score = 29.9 bits (64), Expect = 1.7 Identities = 25/82 (30%), Positives = 37/82 (45%), Gaps = 8/82 (9%) Frame = +2 Query: 278 PNMYPRCGSSGSIQNIH-QTPSSSNQNTEDEDDSGDNKA----SALSFKERRREA---HT 433 PN GS G + N QT + + +G A S + RR +A H+ Sbjct: 91 PNFQIPQGSGGGLMNQQGQTQTQTQPQASASTATGGTVAAPPQSRTKIRARRGQATDPHS 150 Query: 434 QAEQKRRDAIKKGYDSLQDLVP 499 AE+ RR+ I + +LQ+LVP Sbjct: 151 IAERLRRERIAERMKALQELVP 172 >At4g02590.1 68417.m00353 basic helix-loop-helix (bHLH) family protein similar to A. thaliana putative protein F6I18.110, GenBank accession number 2980768 Length = 310 Score = 29.5 bits (63), Expect = 2.2 Identities = 14/35 (40%), Positives = 22/35 (62%) Frame = +2 Query: 422 EAHTQAEQKRRDAIKKGYDSLQDLVPTCQRVMRLA 526 + H+ AE+ RR+ I + +LQ+LVPT + R A Sbjct: 155 DPHSIAERLRRERIAERIRALQELVPTVNKTDRAA 189 >At2g22750.1 68415.m02697 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 304 Score = 29.5 bits (63), Expect = 2.2 Identities = 12/46 (26%), Positives = 27/46 (58%) Frame = +2 Query: 377 GDNKASALSFKERRREAHTQAEQKRRDAIKKGYDSLQDLVPTCQRV 514 G +A +L+ + + H AE+KRR+ + + + +L L+P +++ Sbjct: 110 GTKRAQSLTRSQSNAQDHILAERKRREKLTQRFVALSALIPGLKKM 155 >At1g22450.1 68414.m02806 cytochrome c oxidase subunit 6b, putative (COX6b) nearly identical to subunit 6b of cytochrome c oxidase [Arabidopsis thaliana] GI:6518353 Length = 191 Score = 29.5 bits (63), Expect = 2.2 Identities = 16/47 (34%), Positives = 24/47 (51%) Frame = +2 Query: 329 QTPSSSNQNTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDAIKK 469 QTPS S Q +++ D A + KE E TQAE+ + + K+ Sbjct: 8 QTPSLSEQYHLEKEVKQDTSAKPVEVKEVAPEVTTQAEEVKTEQAKE 54 >At5g16130.1 68418.m01884 40S ribosomal protein S7 (RPS7C) 40S ribosomal protein S7 homolog - Brassica oleracea, EMBL:AF144752 Length = 190 Score = 29.1 bits (62), Expect = 3.0 Identities = 19/69 (27%), Positives = 32/69 (46%) Frame = +2 Query: 368 DDSGDNKASALSFKERRREAHTQAEQKRRDAIKKGYDSLQDLVPTCQRVMRLATNQAKLQ 547 D SG+ KA + R R+A + + ++K + + T +R+MR A +Q Sbjct: 53 DISGNRKAVVIYVPFRLRKAFRKIHPRLVRELEKKFSGKDVIFVTTRRIMRPPKKGAAVQ 112 Query: 548 SFRNQLTTS 574 RN+ TS Sbjct: 113 RPRNRTLTS 121 >At2g03810.2 68415.m00341 18S pre-ribosomal assembly protein gar2-related contains weak similarity to Swiss-Prot:P41891 protein gar2 [Schizosaccharomyces pombe] Length = 439 Score = 29.1 bits (62), Expect = 3.0 Identities = 23/104 (22%), Positives = 40/104 (38%), Gaps = 2/104 (1%) Frame = +2 Query: 296 CGSSGSIQNIHQTPSSSNQNTEDEDDSGDNKASALSFKERRREAHT--QAEQKRRDAIKK 469 C + G I + S NQ+ D + S L KE+R T + E ++ + K+ Sbjct: 247 CLTLGDILSREDEQKSLNQDNISSDSHEEQSPSQLQDKEKRSLETTAIETELEKTEEPKQ 306 Query: 470 GYDSLQDLVPTCQRVMRLATNQAKLQSFRNQLTTSSICYNSVVD 601 G + L + T + N+ + N + + NS D Sbjct: 307 GEEKLSSVSTTTSQEPNKTCNEPEKPETENHHQQNCLVENSYED 350 >At2g03810.1 68415.m00340 18S pre-ribosomal assembly protein gar2-related contains weak similarity to Swiss-Prot:P41891 protein gar2 [Schizosaccharomyces pombe] Length = 439 Score = 29.1 bits (62), Expect = 3.0 Identities = 23/104 (22%), Positives = 40/104 (38%), Gaps = 2/104 (1%) Frame = +2 Query: 296 CGSSGSIQNIHQTPSSSNQNTEDEDDSGDNKASALSFKERRREAHT--QAEQKRRDAIKK 469 C + G I + S NQ+ D + S L KE+R T + E ++ + K+ Sbjct: 247 CLTLGDILSREDEQKSLNQDNISSDSHEEQSPSQLQDKEKRSLETTAIETELEKTEEPKQ 306 Query: 470 GYDSLQDLVPTCQRVMRLATNQAKLQSFRNQLTTSSICYNSVVD 601 G + L + T + N+ + N + + NS D Sbjct: 307 GEEKLSSVSTTTSQEPNKTCNEPEKPETENHHQQNCLVENSYED 350 >At1g01260.1 68414.m00043 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 590 Score = 29.1 bits (62), Expect = 3.0 Identities = 24/88 (27%), Positives = 45/88 (51%), Gaps = 4/88 (4%) Frame = +2 Query: 368 DDSGDNKASALSFKER--RREA--HTQAEQKRRDAIKKGYDSLQDLVPTCQRVMRLATNQ 535 D+SG+N+ + R EA H +AE++RR+ + + + +L+ +VP + M A+ Sbjct: 410 DESGNNRPRKRGRRPANGRAEALNHVEAERQRREKLNQRFYALRSVVPNISK-MDKASLL 468 Query: 536 AKLQSFRNQLTTSSICYNSVVDREEERM 619 S+ N+L V++ E ER+ Sbjct: 469 GDAVSYINELHAKL----KVMEAERERL 492 >At5g63720.1 68418.m07998 hypothetical protein Length = 492 Score = 28.7 bits (61), Expect = 3.9 Identities = 16/54 (29%), Positives = 23/54 (42%) Frame = +2 Query: 329 QTPSSSNQNTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDAIKKGYDSLQD 490 QTPS++ +EDE+ S + S + E TQAE + Y D Sbjct: 272 QTPSATGSESEDEEVSTSQEYSGETGSSSGSEWETQAENDTESKSESSYPPQND 325 >At4g12780.1 68417.m02005 auxilin-related low similarity to SP|Q27974 Auxilin {Bos taurus} Length = 485 Score = 28.7 bits (61), Expect = 3.9 Identities = 29/115 (25%), Positives = 52/115 (45%), Gaps = 2/115 (1%) Frame = +2 Query: 281 NMYPRCGSSGSIQNIHQTPSSSNQNTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDA 460 N YP SSG ++ T ++S +D D + K KERR + + +A + R Sbjct: 17 NGYPD-PSSGEDSDVFSTAAASAAAMKDAMDKAEAKFRHA--KERREKENLKASRSREGD 73 Query: 461 IKKGYDSLQ-DLVPTCQRVMR-LATNQAKLQSFRNQLTTSSICYNSVVDREEERM 619 + YDS + +L R+ R A +A+++ + + ++RE ER+ Sbjct: 74 HTENYDSRERELREKQVRLDRERAEREAEMEKAQEREKEEREREQKRIERERERL 128 >At3g30725.1 68416.m03909 expressed protein ; expression supported by MPSS Length = 111 Score = 28.7 bits (61), Expect = 3.9 Identities = 13/28 (46%), Positives = 18/28 (64%), Gaps = 2/28 (7%) Frame = +2 Query: 326 HQTPSSSNQNT--EDEDDSGDNKASALS 403 HQ PSSS+ N ++EDD GD A ++ Sbjct: 39 HQKPSSSSNNNHMDEEDDVGDKDAKPIT 66 >At2g40200.1 68415.m04943 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 254 Score = 28.7 bits (61), Expect = 3.9 Identities = 19/80 (23%), Positives = 37/80 (46%), Gaps = 3/80 (3%) Frame = +2 Query: 380 DNKASALSFKERRREAHTQAEQKRRDAIKKGYDSLQDLVPTCQRVMR---LATNQAKLQS 550 D+ + E +H AE++RRD I +L+ LVP ++ + LAT +++ Sbjct: 51 DDCVGGIEKAESLSRSHRLAEKRRRDRINSHLTALRKLVPNSDKLDKAALLATVIEQVKE 110 Query: 551 FRNQLTTSSICYNSVVDREE 610 + + S I + + +E Sbjct: 111 LKQKAAESPIFQDLPTEADE 130 >At2g21940.2 68415.m02607 shikimate kinase, putative similar to shikimate kinase precursor from Lycopersicon esculentum [SP|Q00497]; contains Pfam shikimate kinase domain PF01202 Length = 304 Score = 28.3 bits (60), Expect = 5.2 Identities = 20/54 (37%), Positives = 30/54 (55%), Gaps = 9/54 (16%) Frame = +2 Query: 368 DDSGDNKASALSFK------ERRREAHTQAEQK---RRDAIKKGYDSLQDLVPT 502 D+SGD A +++FK + R EA+T A + A K+GY ++ DL PT Sbjct: 226 DESGD--AYSVAFKRLSAIWDERGEAYTNANARVSLENIAAKRGYKNVSDLTPT 277 >At2g21940.1 68415.m02606 shikimate kinase, putative similar to shikimate kinase precursor from Lycopersicon esculentum [SP|Q00497]; contains Pfam shikimate kinase domain PF01202 Length = 303 Score = 28.3 bits (60), Expect = 5.2 Identities = 20/54 (37%), Positives = 30/54 (55%), Gaps = 9/54 (16%) Frame = +2 Query: 368 DDSGDNKASALSFK------ERRREAHTQAEQK---RRDAIKKGYDSLQDLVPT 502 D+SGD A +++FK + R EA+T A + A K+GY ++ DL PT Sbjct: 225 DESGD--AYSVAFKRLSAIWDERGEAYTNANARVSLENIAAKRGYKNVSDLTPT 276 >At1g20920.1 68414.m02619 DEAD box RNA helicase, putative similar to RNA helicase [Rattus norvegicus] GI:897915; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 1166 Score = 28.3 bits (60), Expect = 5.2 Identities = 19/61 (31%), Positives = 27/61 (44%) Frame = +2 Query: 338 SSSNQNTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDAIKKGYDSLQDLVPTCQRVM 517 SS +++ D DD D + KER R + KRR +K DS D+ +R Sbjct: 56 SSDSEDDYDRDD--DEEREKRKEKERERRRRDKDRVKRRSERRKSSDSEDDVEEEDERDK 113 Query: 518 R 520 R Sbjct: 114 R 114 >At5g16500.1 68418.m01928 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 636 Score = 27.9 bits (59), Expect = 6.8 Identities = 12/43 (27%), Positives = 26/43 (60%) Frame = +2 Query: 314 IQNIHQTPSSSNQNTEDEDDSGDNKASALSFKERRREAHTQAE 442 +++IH + S +Q+ +DD+G++ S+L E + E H ++ Sbjct: 593 LEHIHSS-KSEDQSVYSDDDAGESGESSLHRIEAKEEEHISSD 634 >At3g21480.1 68416.m02710 transcription activation domain-interacting protein-related contains weak similarity to Pax transcription activation domain interacting protein PTIP (GI:4336734) [Mus musculus] Length = 1045 Score = 27.9 bits (59), Expect = 6.8 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = +2 Query: 347 NQNTEDEDDSGDNKASALSFKERRREAHTQAE 442 N + D DDSG + LS +E R++A+ + + Sbjct: 128 NSDLSDSDDSGSKAETVLSSEENRQDANEKVK 159 >At5g41090.1 68418.m04995 no apical meristem (NAM) family protein contains Pfam PF02365: No apical meristem (NAM) domain; similar to unknown protein (emb|CAB88055.1) Length = 212 Score = 27.5 bits (58), Expect = 9.0 Identities = 14/33 (42%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Frame = +2 Query: 320 NIHQTPSSSNQNTEDEDDSGDNKASAL-SFKER 415 N+H S S E+ED+S D A +L S KE+ Sbjct: 168 NLHIVESESESEEEEEDESVDKPAESLDSVKEK 200 >At4g38600.2 68417.m05463 HECT-domain-containing protein / ubiquitin-transferase family protein similar to SP|Q14669Thyroid receptor interacting protein 12 (TRIP12) {Homo sapiens}; contains Pfam profile PF00632: HECT-domain (ubiquitin-transferase) Length = 1794 Score = 27.5 bits (58), Expect = 9.0 Identities = 13/36 (36%), Positives = 15/36 (41%) Frame = +2 Query: 353 NTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDA 460 N D D G K + +ER RE EQ DA Sbjct: 20 NNNDNSDKGKEKEHDVRIRERERERDRAREQLNMDA 55 >At4g38600.1 68417.m05464 HECT-domain-containing protein / ubiquitin-transferase family protein similar to SP|Q14669Thyroid receptor interacting protein 12 (TRIP12) {Homo sapiens}; contains Pfam profile PF00632: HECT-domain (ubiquitin-transferase) Length = 1888 Score = 27.5 bits (58), Expect = 9.0 Identities = 13/36 (36%), Positives = 15/36 (41%) Frame = +2 Query: 353 NTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDA 460 N D D G K + +ER RE EQ DA Sbjct: 93 NNNDNSDKGKEKEHDVRIRERERERDRAREQLNMDA 128 >At3g14010.1 68416.m01769 hydroxyproline-rich glycoprotein family protein similar to Mrs16p (GI:2737884) [Saccharomyces cerevisiae]; weak similarity to ataxin-2 related protein (GI:1679686) [Homo sapiens] Length = 595 Score = 27.5 bits (58), Expect = 9.0 Identities = 16/53 (30%), Positives = 27/53 (50%) Frame = +2 Query: 302 SSGSIQNIHQTPSSSNQNTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDA 460 SS +N+ Q+ S+S Q ++D +G N S E+RR+ + + R A Sbjct: 330 SSRKNKNVDQSCSTSKQQSKDFPAAGSN-ISESQLDEQRRKNNEEVSHNNRSA 381 >At2g27690.1 68415.m03355 cytochrome P450, putative similar to Cytochrome P450 94A1 (P450-dependent fatty acid omega-hydroxylase) (SP:O81117) {Vicia sativa}; contains Pfam profile: PF00067 cytochrome P450; supported by cDNA: gi_13877668 Length = 495 Score = 27.5 bits (58), Expect = 9.0 Identities = 9/36 (25%), Positives = 21/36 (58%) Frame = -2 Query: 325 YVLNRSATATTRIHIGILIVIMKLNKIKHYINAIFH 218 ++L RS T+T ++H+ ++ + ++H + FH Sbjct: 58 HLLRRSPTSTIKVHVLNSVITANPSNVEHILKTNFH 93 >At2g20310.1 68415.m02372 expressed protein Length = 430 Score = 27.5 bits (58), Expect = 9.0 Identities = 10/22 (45%), Positives = 16/22 (72%) Frame = +2 Query: 308 GSIQNIHQTPSSSNQNTEDEDD 373 G + + ++ P+SSNQ ED+DD Sbjct: 56 GGVNSQYRKPNSSNQALEDDDD 77 >At2g06210.2 68415.m00683 phosphoprotein-related low similarity to phosphoprotein from Mus musculus GI:1236239; contains Pfam profile PF00515 TPR Domain Length = 852 Score = 27.5 bits (58), Expect = 9.0 Identities = 16/57 (28%), Positives = 29/57 (50%) Frame = +2 Query: 332 TPSSSNQNTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDAIKKGYDSLQDLVPT 502 TP S+ + EDD G++K S ERRR+ + +K + + + Y+ ++ T Sbjct: 691 TPGSNKRKDRVEDDDGESKPS-----ERRRKKGGKRRKKDKSSRARHYEDDEEEAAT 742 >At2g06210.1 68415.m00684 phosphoprotein-related low similarity to phosphoprotein from Mus musculus GI:1236239; contains Pfam profile PF00515 TPR Domain Length = 1064 Score = 27.5 bits (58), Expect = 9.0 Identities = 16/57 (28%), Positives = 29/57 (50%) Frame = +2 Query: 332 TPSSSNQNTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDAIKKGYDSLQDLVPT 502 TP S+ + EDD G++K S ERRR+ + +K + + + Y+ ++ T Sbjct: 903 TPGSNKRKDRVEDDDGESKPS-----ERRRKKGGKRRKKDKSSRARHYEDDEEEAAT 954 >At1g50410.1 68414.m05650 SNF2 domain-containing protein / helicase domain-containing protein / RING finger domain-containing protein similar to transcription factor RUSH-1alpha [Oryctolagus cuniculus] GI:1655930; contains Pfam profiles PF00271: Helicase conserved C-terminal domain, PF00176: SNF2 family N-terminal domain, PF00097: Zinc finger, C3HC4 type (RING finger) Length = 981 Score = 27.5 bits (58), Expect = 9.0 Identities = 14/29 (48%), Positives = 18/29 (62%) Frame = +2 Query: 299 GSSGSIQNIHQTPSSSNQNTEDEDDSGDN 385 G+S S QN Q SSS Q +D+DD D+ Sbjct: 781 GTSNSTQN-GQMASSSQQPNDDDDDDDDD 808 >At1g42990.1 68414.m04949 bZIP transcription factor family protein contains Pfam profile: PF00170: bZIP transcription factor Length = 295 Score = 27.5 bits (58), Expect = 9.0 Identities = 23/104 (22%), Positives = 52/104 (50%), Gaps = 3/104 (2%) Frame = +2 Query: 341 SSNQNTEDEDDSGDNKASALSFKE--RRREAHTQAEQKRRDAIKKGYDSLQDLVPTCQRV 514 S ++ +D+D+ GD+ A A + R R+A ++ +++++ ++ + L C R+ Sbjct: 123 SGSEIHDDDDEEGDDDAVAKKRRRRVRNRDAAVRSRERKKEYVQDLEKKSKYLERECLRL 182 Query: 515 MR-LATNQAKLQSFRNQLTTSSICYNSVVDREEERMHCVKMLSL 643 R L A+ QS R L + +++ ++E + ++ L L Sbjct: 183 GRMLECFVAENQSLRYCLQKGNGNNTTMMSKQESAVLLLESLLL 226 >At1g27740.1 68414.m03390 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 258 Score = 27.5 bits (58), Expect = 9.0 Identities = 24/72 (33%), Positives = 32/72 (44%), Gaps = 11/72 (15%) Frame = +2 Query: 332 TPSSSNQNTED----EDDSGDNKASALSFKERRREAHTQAE-------QKRRDAIKKGYD 478 T SN N D + S D KAS S K + R A +KRR+ I + Sbjct: 135 TVDESNTNWVDGQSLSNSSDDEKASVTSVKGKTRATKGTATDPQSLYARKRREKINERLK 194 Query: 479 SLQDLVPTCQRV 514 +LQ+LVP +V Sbjct: 195 TLQNLVPNGTKV 206 >At1g14687.1 68414.m01755 zinc finger homeobox family protein / ZF-HD homeobox family protein Length = 168 Score = 27.5 bits (58), Expect = 9.0 Identities = 14/43 (32%), Positives = 25/43 (58%) Frame = +2 Query: 338 SSSNQNTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDAIK 466 ++ +N E+EDD+ + +RRR++ AEQ R+A+K Sbjct: 82 TAEERNEEEEDDTEETSTEEKMTVQRRRKSKFTAEQ--REAMK 122 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,489,350 Number of Sequences: 28952 Number of extensions: 268101 Number of successful extensions: 1210 Number of sequences better than 10.0: 80 Number of HSP's better than 10.0 without gapping: 1152 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1198 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1496852856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -