BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0007 (585 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY187043-1|AAO39757.1| 171|Anopheles gambiae putative antennal ... 25 1.8 AF042732-3|AAC18058.1| 496|Anopheles gambiae diphenol oxidase-A... 24 3.2 AJ970245-1|CAI96717.1| 134|Anopheles gambiae putative reverse t... 24 4.2 >AY187043-1|AAO39757.1| 171|Anopheles gambiae putative antennal carrier protein AP-1 protein. Length = 171 Score = 25.0 bits (52), Expect = 1.8 Identities = 15/48 (31%), Positives = 19/48 (39%) Frame = +2 Query: 350 NNNINCDHLLTDKSGRKITRNQKRKHDEINHVQKTYAEMDPTTAALEK 493 N I CD L K + D++N VQ T +DP A K Sbjct: 52 NGTIICDTLKCPAESFKCVIVKNSTKDDVNKVQVTRECLDPAGKATAK 99 >AF042732-3|AAC18058.1| 496|Anopheles gambiae diphenol oxidase-A2 protein. Length = 496 Score = 24.2 bits (50), Expect = 3.2 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = +2 Query: 245 LLRNYVHYVGYDR 283 LLRNY+HY YD+ Sbjct: 217 LLRNYLHYSLYDQ 229 >AJ970245-1|CAI96717.1| 134|Anopheles gambiae putative reverse transcriptase protein. Length = 134 Score = 23.8 bits (49), Expect = 4.2 Identities = 11/38 (28%), Positives = 19/38 (50%) Frame = -3 Query: 169 CSPMSKGCSGTDSESSLSVLRHSGLGNSLFTIGFSNSL 56 C+ S G + D+E + + H GL + L + F + L Sbjct: 62 CNRKSTGLALLDTEKAFDSIWHQGLLSKLIKLNFPSYL 99 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 639,765 Number of Sequences: 2352 Number of extensions: 12470 Number of successful extensions: 19 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 55927431 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -