BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0007 (585 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY155490-1|AAO12861.1| 342|Apis mellifera Ammar1 transposase pr... 27 0.18 DQ257631-1|ABB82366.1| 424|Apis mellifera yellow e3-like protei... 23 2.2 AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor typ... 22 3.9 AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice... 21 8.9 >AY155490-1|AAO12861.1| 342|Apis mellifera Ammar1 transposase protein. Length = 342 Score = 26.6 bits (56), Expect = 0.18 Identities = 17/73 (23%), Positives = 35/73 (47%), Gaps = 7/73 (9%) Frame = +2 Query: 227 IQYSGILLRNYVHYVGYDRRLDEWVS---RHRVMSDRFDVCE----QSNNNINCDHLLTD 385 + S + N++ +GY ++LD WV + + ++ R + C+ ++ N+ L+T Sbjct: 93 LHVSHTCIENHLKQLGYVQKLDTWVPHELKEKHLTQRINSCDLLKKRNENDPFLKRLITG 152 Query: 386 KSGRKITRNQKRK 424 + N KRK Sbjct: 153 DEKWVVYNNIKRK 165 >DQ257631-1|ABB82366.1| 424|Apis mellifera yellow e3-like protein protein. Length = 424 Score = 23.0 bits (47), Expect = 2.2 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +1 Query: 502 SYSKVKYIDRDTNLENMEID 561 SY+ VKY D T++ M++D Sbjct: 110 SYNDVKYCDGLTSVYRMQVD 129 >AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor type D2 protein. Length = 456 Score = 22.2 bits (45), Expect = 3.9 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = -2 Query: 368 RSLCYCSTARIRRTY 324 R LC C R+RR Y Sbjct: 403 RILCACCPGRVRRRY 417 >AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice variant B protein. Length = 810 Score = 21.0 bits (42), Expect = 8.9 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +1 Query: 520 YIDRDTNLENMEIDT 564 YID++T N+EI T Sbjct: 460 YIDKETKDMNLEIST 474 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 173,933 Number of Sequences: 438 Number of extensions: 3680 Number of successful extensions: 7 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 16993167 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -