BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0004 (543 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EU019713-1|ABU25225.1| 528|Tribolium castaneum chitin deacetyla... 22 3.0 EU019712-1|ABU25224.1| 535|Tribolium castaneum chitin deacetyla... 22 3.0 AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 22 3.0 AF225975-2|AAF74116.1| 302|Tribolium castaneum Tc-tailless prot... 21 9.2 AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholo... 21 9.2 >EU019713-1|ABU25225.1| 528|Tribolium castaneum chitin deacetylase 2B protein. Length = 528 Score = 22.2 bits (45), Expect = 3.0 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = -3 Query: 127 CIDESYENVCTV 92 C DES EN CTV Sbjct: 134 CKDESDENSCTV 145 >EU019712-1|ABU25224.1| 535|Tribolium castaneum chitin deacetylase 2A protein. Length = 535 Score = 22.2 bits (45), Expect = 3.0 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = -3 Query: 127 CIDESYENVCTV 92 C DES EN CTV Sbjct: 141 CKDESDENSCTV 152 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 22.2 bits (45), Expect = 3.0 Identities = 13/43 (30%), Positives = 20/43 (46%), Gaps = 2/43 (4%) Frame = -3 Query: 538 FKLFSDFHYSGI--WACVTLTSPVYIYSRSALISKSLTPGNRI 416 + +SD G+ W VTL Y+ S+ + L GNR+ Sbjct: 671 YTTYSDVWSFGVLLWEIVTLGGTPYVGVHSSELLDFLKSGNRL 713 >AF225975-2|AAF74116.1| 302|Tribolium castaneum Tc-tailless protein. Length = 302 Score = 20.6 bits (41), Expect = 9.2 Identities = 8/24 (33%), Positives = 12/24 (50%) Frame = +3 Query: 342 HRVVLAANSPYFQSILADVPMDHC 413 HR+ + SP S + D+P C Sbjct: 18 HRMQIKPQSPSSSSRILDIPCKVC 41 >AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholog protein. Length = 406 Score = 20.6 bits (41), Expect = 9.2 Identities = 8/24 (33%), Positives = 12/24 (50%) Frame = +3 Query: 342 HRVVLAANSPYFQSILADVPMDHC 413 HR+ + SP S + D+P C Sbjct: 18 HRMQIKPQSPSSSSRILDIPCKVC 41 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 134,989 Number of Sequences: 336 Number of extensions: 3049 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 13306679 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -