BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0002 (431 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF106582-1|AAC78217.3| 1424|Caenorhabditis elegans Hypothetical ... 29 1.1 AC199166-1|ABO33245.1| 343|Caenorhabditis elegans F-box a prote... 27 4.4 U58739-2|AAB00608.1| 391|Caenorhabditis elegans Hypothetical pr... 27 5.8 AF039038-1|AAK21435.1| 877|Caenorhabditis elegans Hypothetical ... 27 5.8 >AF106582-1|AAC78217.3| 1424|Caenorhabditis elegans Hypothetical protein W05F2.7 protein. Length = 1424 Score = 29.5 bits (63), Expect = 1.1 Identities = 20/53 (37%), Positives = 28/53 (52%), Gaps = 5/53 (9%) Frame = +3 Query: 273 SNGD-INSAGDILTQNQQ----KGWWTIGLINSRYRYLTAETFGFKINANGTS 416 S GD +++A + LT N G W G +NS R+LT T+ N NGT+ Sbjct: 982 STGDFLSNAWNSLTSNNSTGGGNGTWISGALNSTGRFLT-NTWNLLGNCNGTA 1033 >AC199166-1|ABO33245.1| 343|Caenorhabditis elegans F-box a protein protein 6 protein. Length = 343 Score = 27.5 bits (58), Expect = 4.4 Identities = 24/95 (25%), Positives = 47/95 (49%), Gaps = 5/95 (5%) Frame = -3 Query: 270 VRSL*FFTLELVYTAEEMQSRDREKTTK-CT---NYKNIIIIYISLHFSSIRLTLNCRN- 106 ++S+ + LE + E++ D+ K +K C +Y NII I+ HF +I T+ + Sbjct: 198 LKSIELWCLETIDDFEQLTRMDQWKKSKECKVFGHYFNIIPIHYLFHFENIEATVEYFSA 257 Query: 105 LS*ITVKKNCRFILSGEFLKCKIFINAYVSHSCSR 1 L+ + ++ N + F +C +I +S +R Sbjct: 258 LNALNIRNN--LLGRSTFQQCIFWIYGTISVEVAR 290 >U58739-2|AAB00608.1| 391|Caenorhabditis elegans Hypothetical protein F28C10.4 protein. Length = 391 Score = 27.1 bits (57), Expect = 5.8 Identities = 11/31 (35%), Positives = 19/31 (61%) Frame = +2 Query: 47 FKNSPDNINRQFFLTVIYDRFRQLSVNLIDE 139 F+N PD +N + ++Y + +S+N IDE Sbjct: 236 FENLPDFLNFKSIDRILYRTSKNMSINQIDE 266 >AF039038-1|AAK21435.1| 877|Caenorhabditis elegans Hypothetical protein K06A5.4 protein. Length = 877 Score = 27.1 bits (57), Expect = 5.8 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -2 Query: 229 RRRNAIARSRENHKMH 182 RRR A+AR +EN KMH Sbjct: 695 RRRGAVARVKENVKMH 710 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,985,544 Number of Sequences: 27780 Number of extensions: 168032 Number of successful extensions: 430 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 425 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 430 length of database: 12,740,198 effective HSP length: 75 effective length of database: 10,656,698 effective search space used: 724655464 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -