BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0001 (710 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_57156| Best HMM Match : DUF1456 (HMM E-Value=4.9) 29 4.9 SB_58276| Best HMM Match : MIB_HERC2 (HMM E-Value=8.3e-33) 29 4.9 >SB_57156| Best HMM Match : DUF1456 (HMM E-Value=4.9) Length = 501 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = -2 Query: 343 PSTVLQD*DC*LFGSESASLCIKTSHVPATRPRPYAV 233 P + D D F + S+S C+ T+H P T PR Y + Sbjct: 215 PFSGKSDSDTSHFMAPSSSACLDTNHNPLTPPRSYGL 251 >SB_58276| Best HMM Match : MIB_HERC2 (HMM E-Value=8.3e-33) Length = 2822 Score = 28.7 bits (61), Expect = 4.9 Identities = 22/89 (24%), Positives = 42/89 (47%), Gaps = 1/89 (1%) Frame = -1 Query: 470 HSDLIFGIYYSGGEHSYQFLLSHQFFFKCCQAELSR*RTS-TDSVHSSTGLRLLIVWVRI 294 H+ + + +G +SY+ ++ K + S TS T + SST + V Sbjct: 1283 HNGWVEVSWNNGTSNSYRMGADGKYDLKVIEPNPSTTPTSSTPTSSSSTSTPTTLNTVTS 1342 Query: 293 SLIVYQNEPRPSDQASSVCGVASQQLATK 207 SL++ Q P +DQ +S +SQ+++ + Sbjct: 1343 SLLMMQERPSTADQGASSDSGSSQEVSPR 1371 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,398,903 Number of Sequences: 59808 Number of extensions: 401804 Number of successful extensions: 678 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 669 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 678 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1877743452 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -