BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0960 (841 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_51792| Best HMM Match : SH2 (HMM E-Value=6.3e-24) 74 2e-13 SB_40820| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 62 4e-10 SB_33662| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_35674| Best HMM Match : SH2 (HMM E-Value=0) 60 2e-09 SB_34104| Best HMM Match : SH2 (HMM E-Value=1.6e-24) 59 4e-09 SB_16900| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_18647| Best HMM Match : SH2 (HMM E-Value=7.3e-16) 59 5e-09 SB_33664| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 3e-08 SB_26266| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 56 3e-08 SB_41533| Best HMM Match : SH2 (HMM E-Value=6.3e-25) 55 6e-08 SB_15740| Best HMM Match : SH2 (HMM E-Value=8.1e-18) 54 1e-07 SB_7446| Best HMM Match : SH2 (HMM E-Value=2.7e-22) 53 3e-07 SB_55759| Best HMM Match : SH2 (HMM E-Value=0.082) 53 3e-07 SB_13732| Best HMM Match : SH2 (HMM E-Value=3.6e-12) 53 3e-07 SB_48419| Best HMM Match : SH2 (HMM E-Value=4.6e-13) 51 1e-06 SB_22865| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_33663| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_6049| Best HMM Match : SH2 (HMM E-Value=8.4e-30) 50 3e-06 SB_10902| Best HMM Match : SH3_1 (HMM E-Value=0) 44 1e-04 SB_51507| Best HMM Match : SH2 (HMM E-Value=2.3e-22) 44 1e-04 SB_42044| Best HMM Match : ubiquitin (HMM E-Value=1.2e-06) 44 1e-04 SB_7592| Best HMM Match : PI-PLC-Y (HMM E-Value=1.1e-33) 44 1e-04 SB_27771| Best HMM Match : SH2 (HMM E-Value=8.6e-16) 39 0.006 SB_34759| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_17929| Best HMM Match : SH2 (HMM E-Value=5e-08) 37 0.018 SB_58219| Best HMM Match : SOCS_box (HMM E-Value=2e-07) 35 0.094 SB_48515| Best HMM Match : SH2 (HMM E-Value=3.1) 34 0.12 SB_30637| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.38 SB_20077| Best HMM Match : zf-RanBP (HMM E-Value=0.24) 32 0.50 SB_47880| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.67 SB_28180| Best HMM Match : Ank (HMM E-Value=1.5e-15) 31 0.88 SB_54309| Best HMM Match : SH2 (HMM E-Value=5.1e-17) 31 0.88 SB_37681| Best HMM Match : SH2 (HMM E-Value=3.5e-11) 31 1.2 SB_5939| Best HMM Match : BAH (HMM E-Value=7.9e-18) 30 2.0 SB_50497| Best HMM Match : CH (HMM E-Value=0.0084) 30 2.7 SB_37909| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_34518| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_19207| Best HMM Match : ig (HMM E-Value=1.2e-11) 29 4.7 SB_14500| Best HMM Match : Vicilin_N (HMM E-Value=5.3) 29 4.7 SB_1337| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.7 SB_56452| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.2 SB_41671| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.2 SB_31513| Best HMM Match : Transgly_assoc (HMM E-Value=0.49) 29 6.2 SB_25082| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.2 SB_4447| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.2 SB_53888| Best HMM Match : TSP_3 (HMM E-Value=9.2e-11) 29 6.2 SB_49656| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.2 SB_30302| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.2 SB_24557| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.2 SB_14435| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.2 SB_3849| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.2 SB_33968| Best HMM Match : Transformer (HMM E-Value=5.1) 28 8.2 SB_58795| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.2 SB_9897| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.2 >SB_51792| Best HMM Match : SH2 (HMM E-Value=6.3e-24) Length = 189 Score = 73.7 bits (173), Expect = 2e-13 Identities = 35/71 (49%), Positives = 50/71 (70%), Gaps = 1/71 (1%) Frame = +1 Query: 298 WFHGKISRESAEKLLKEEGE-DGVFLVRESNTSPGDYVLSVLHQGQVVHYQIRRHGEDAF 474 WFHG++SRE+A +L + G+ +G+FLVRES T PGDYVLS+ Q +H+QI+ G D + Sbjct: 9 WFHGEMSREAAVDILVKHGKKEGLFLVRESKTIPGDYVLSLWTTNQALHFQIQCRG-DIY 67 Query: 475 FSIEEHTTVHG 507 F I++ HG Sbjct: 68 FCIDDGPIFHG 78 Score = 52.4 bits (120), Expect = 4e-07 Identities = 26/70 (37%), Positives = 40/70 (57%) Frame = +3 Query: 507 MDTLIQHYRSDSNGLVTRLSIVCKGEPPPHESRTQGTTNLLHRATEAGHFNVVSKLLGKR 686 +D+L+ +YR +++GL RL+ C G PPP + G LH+A G+ N+V KLL + Sbjct: 79 LDSLVDYYRENADGLPIRLTQFCPGIPPPSSTCKHGYQTPLHQACRDGNINLVQKLLREN 138 Query: 687 ATGVATPRNQ 716 V RN+ Sbjct: 139 PLDV-NARNE 147 >SB_40820| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 526 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/51 (56%), Positives = 36/51 (70%) Frame = +1 Query: 298 WFHGKISRESAEKLLKEEGEDGVFLVRESNTSPGDYVLSVLHQGQVVHYQI 450 WFHGKI RE +E+LL+ DG+FLVRES GDY LSV G+V HY++ Sbjct: 203 WFHGKIEREKSEELLQPR-TDGLFLVRESRNYVGDYTLSVCCNGKVEHYRV 252 Score = 28.3 bits (60), Expect = 8.2 Identities = 10/16 (62%), Positives = 15/16 (93%) Frame = +3 Query: 516 LIQHYRSDSNGLVTRL 563 L++HY++DS+GL TRL Sbjct: 273 LVEHYQNDSDGLCTRL 288 >SB_33662| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 509 Score = 61.3 bits (142), Expect = 1e-09 Identities = 30/60 (50%), Positives = 35/60 (58%) Frame = +1 Query: 298 WFHGKISRESAEKLLKEEGEDGVFLVRESNTSPGDYVLSVLHQGQVVHYQIRRHGEDAFF 477 WF G I R AEKLL GE G FL+RES + PGDY LS+ V HY+IR F+ Sbjct: 127 WFFGAIRRVDAEKLLIMHGESGSFLIRESESKPGDYSLSLRDGDNVKHYRIRCLDNGGFY 186 >SB_35674| Best HMM Match : SH2 (HMM E-Value=0) Length = 871 Score = 60.1 bits (139), Expect = 2e-09 Identities = 26/56 (46%), Positives = 35/56 (62%) Frame = +1 Query: 298 WFHGKISRESAEKLLKEEGEDGVFLVRESNTSPGDYVLSVLHQGQVVHYQIRRHGE 465 WFH +S AE+LL E G G +LVR S ++PGD+ LSV G V H +I+ G+ Sbjct: 480 WFHSNVSGHDAERLLIERGLHGSYLVRPSKSNPGDFTLSVRRNGDVTHIKIQNTGD 535 Score = 48.0 bits (109), Expect = 9e-06 Identities = 20/46 (43%), Positives = 30/46 (65%) Frame = +1 Query: 322 ESAEKLLKEEGEDGVFLVRESNTSPGDYVLSVLHQGQVVHYQIRRH 459 + E +L ++G++G FLVRES + PGDYVL+ ++ H IR H Sbjct: 586 KEGETVLLDKGKNGSFLVRESQSKPGDYVLTARCDDRITHVMIRNH 631 >SB_34104| Best HMM Match : SH2 (HMM E-Value=1.6e-24) Length = 421 Score = 59.3 bits (137), Expect = 4e-09 Identities = 29/57 (50%), Positives = 39/57 (68%), Gaps = 1/57 (1%) Frame = +1 Query: 298 WFHGKISRESAEKLLKEEGE-DGVFLVRESNTSPGDYVLSVLHQGQVVHYQIRRHGE 465 +FHG ISR AE+LL G+ DG++LVRES G Y LS+ + +V+HYQI RH + Sbjct: 10 YFHGCISRFKAEELLARAGKRDGLYLVRESAHQLGSYALSMCNNHKVIHYQILRHAD 66 Score = 29.1 bits (62), Expect = 4.7 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = +1 Query: 298 WFHGKISRESAEKLL 342 WFHG ISRE AE+ L Sbjct: 160 WFHGNISREEAERRL 174 >SB_16900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 451 Score = 59.3 bits (137), Expect = 4e-09 Identities = 27/74 (36%), Positives = 48/74 (64%) Frame = +1 Query: 256 NSFLLRMNREDNVNWFHGKISRESAEKLLKEEGEDGVFLVRESNTSPGDYVLSVLHQGQV 435 +S++ +N + +W+HG+ISR +AE LL G +G FLVRES +SPG +S+ + +V Sbjct: 89 SSYIKPVNSLEKHSWYHGQISRNAAEYLLSS-GINGSFLVRESESSPGQLSISLRYDERV 147 Query: 436 VHYQIRRHGEDAFF 477 HY++ ++ ++ Sbjct: 148 YHYRVSTSVDNKYY 161 >SB_18647| Best HMM Match : SH2 (HMM E-Value=7.3e-16) Length = 720 Score = 58.8 bits (136), Expect = 5e-09 Identities = 27/60 (45%), Positives = 37/60 (61%) Frame = +1 Query: 298 WFHGKISRESAEKLLKEEGEDGVFLVRESNTSPGDYVLSVLHQGQVVHYQIRRHGEDAFF 477 W H I+R EKLL GEDG FL+R+S + P +VLS+L QG + HY+I R + + Sbjct: 5 WHHKAINRLETEKLLLGCGEDGGFLIRDSESIPNAFVLSILFQGHIHHYRILREKDGRLY 64 >SB_33664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 525 Score = 56.4 bits (130), Expect = 3e-08 Identities = 28/62 (45%), Positives = 36/62 (58%), Gaps = 1/62 (1%) Frame = +1 Query: 295 NWFHGKISRESAEKLLKEEGED-GVFLVRESNTSPGDYVLSVLHQGQVVHYQIRRHGEDA 471 +WF GKI R AEK L G G FL+R+S T PG++ LSV V HY+IR+ Sbjct: 141 DWFFGKIKRAEAEKKLLAPGNPKGTFLIRDSETQPGNFSLSVRDGDNVKHYRIRKLDTGG 200 Query: 472 FF 477 F+ Sbjct: 201 FY 202 Score = 31.9 bits (69), Expect = 0.67 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = +3 Query: 516 LIQHYRSDSNGLVTRLSIVCKGEPPPHESRTQGT 617 L+ HY D++GL L+ C GE P + GT Sbjct: 215 LVDHYMQDADGLCCMLTQACSGEKPQTAGLSYGT 248 >SB_26266| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 1038 Score = 56.4 bits (130), Expect = 3e-08 Identities = 30/64 (46%), Positives = 38/64 (59%) Frame = +1 Query: 298 WFHGKISRESAEKLLKEEGEDGVFLVRESNTSPGDYVLSVLHQGQVVHYQIRRHGEDAFF 477 WFHG I R+ +K LK +GE +LVRES T PG +VLS G + H+ I+ ED F Sbjct: 408 WFHGIIQRKDVDKRLKSDGE---YLVRESATKPGQFVLSARSDGALRHFIIQTM-EDGFV 463 Query: 478 SIEE 489 EE Sbjct: 464 RFEE 467 >SB_41533| Best HMM Match : SH2 (HMM E-Value=6.3e-25) Length = 389 Score = 55.2 bits (127), Expect = 6e-08 Identities = 23/66 (34%), Positives = 41/66 (62%) Frame = +1 Query: 253 ENSFLLRMNREDNVNWFHGKISRESAEKLLKEEGEDGVFLVRESNTSPGDYVLSVLHQGQ 432 E++ L ++ + W+HGK+ R++ E+ L +G G +LVRES+ P + LS L + Sbjct: 39 EHNIELSLSAPPDDRWYHGKLDRKTCEERLAADGRIGAYLVRESDRKPATFSLSYLGKNG 98 Query: 433 VVHYQI 450 +VH++I Sbjct: 99 IVHFRI 104 >SB_15740| Best HMM Match : SH2 (HMM E-Value=8.1e-18) Length = 453 Score = 54.4 bits (125), Expect = 1e-07 Identities = 28/52 (53%), Positives = 36/52 (69%), Gaps = 2/52 (3%) Frame = +1 Query: 301 FHGKISRESAEKLLKEEGE--DGVFLVRESNTSPGDYVLSVLHQGQVVHYQI 450 FHGKISRE +LL G +G FLVRES ++PGDY LS+ G+V HY++ Sbjct: 59 FHGKISREQVVELLTGAGGTVNGRFLVRESLSAPGDYSLSLTFGGEVEHYRL 110 >SB_7446| Best HMM Match : SH2 (HMM E-Value=2.7e-22) Length = 699 Score = 53.2 bits (122), Expect = 3e-07 Identities = 26/49 (53%), Positives = 33/49 (67%) Frame = +1 Query: 295 NWFHGKISRESAEKLLKEEGEDGVFLVRESNTSPGDYVLSVLHQGQVVH 441 +W+HG ISR AE LL++EG+ FLVRES + PG YVLS + Q H Sbjct: 448 DWYHGPISRGEAELLLEDEGD---FLVRESKSQPGQYVLSGIKDKQARH 493 >SB_55759| Best HMM Match : SH2 (HMM E-Value=0.082) Length = 42 Score = 52.8 bits (121), Expect = 3e-07 Identities = 21/39 (53%), Positives = 30/39 (76%) Frame = +1 Query: 298 WFHGKISRESAEKLLKEEGEDGVFLVRESNTSPGDYVLS 414 WFHG +S + E +L ++G++G FLVRES + PGDYVL+ Sbjct: 2 WFHGHMSSKEGETVLLDKGKNGSFLVRESQSKPGDYVLT 40 >SB_13732| Best HMM Match : SH2 (HMM E-Value=3.6e-12) Length = 135 Score = 52.8 bits (121), Expect = 3e-07 Identities = 35/105 (33%), Positives = 55/105 (52%), Gaps = 7/105 (6%) Frame = +1 Query: 298 WFHGKISRESAEKLLKEEG-EDGVFLVRESNTSPGDYVLSVLHQGQVVHYQIRRH---GE 465 WFHG+IS + A L+K EG EDG+FLVRES + YVL+ +V H Q+ + G Sbjct: 27 WFHGRISHDEALVLMKREGFEDGLFLVRESCSVSDVYVLTFCMNKKVFHCQLVQDIGPGS 86 Query: 466 DAFFSIEE---HTTVHGWILLYNITVVIQMDLLLGCPLSVKENHH 591 ++ +++ ++ I Y V + + LG P +VK + Sbjct: 87 KMYYRLDKGPAFPSILELIRYYQRKTVNGISVALGRPCTVKRRRN 131 >SB_48419| Best HMM Match : SH2 (HMM E-Value=4.6e-13) Length = 274 Score = 51.2 bits (117), Expect = 1e-06 Identities = 22/58 (37%), Positives = 37/58 (63%), Gaps = 2/58 (3%) Frame = +1 Query: 298 WFHGKISRESAEKLLKEEGED--GVFLVRESNTSPGDYVLSVLHQGQVVHYQIRRHGE 465 WFHG +SR A +L+ + + G+FL+R+S T G+YVL+ +QG+ H ++ + E Sbjct: 109 WFHGTLSRIEASQLVSQGSQQWHGIFLIRQSETRRGEYVLTFNYQGRAKHLRLSLNNE 166 >SB_22865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 315 Score = 51.2 bits (117), Expect = 1e-06 Identities = 26/52 (50%), Positives = 34/52 (65%), Gaps = 1/52 (1%) Frame = +1 Query: 298 WFHGKISRESAEKLLKEEG-EDGVFLVRESNTSPGDYVLSVLHQGQVVHYQI 450 WFHG+IS + A L+K EG EDG+FLVRES + YVL+ +V H Q+ Sbjct: 27 WFHGRISHDEALVLMKREGFEDGLFLVRESCSVSDVYVLTFCMNKKVFHCQL 78 >SB_33663| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 518 Score = 50.0 bits (114), Expect = 2e-06 Identities = 27/74 (36%), Positives = 40/74 (54%), Gaps = 1/74 (1%) Frame = +1 Query: 259 SFLLRMNREDNVNWFHGKISRESAEKLLKE-EGEDGVFLVRESNTSPGDYVLSVLHQGQV 435 +++ M + WF+G I R AEKLL+ E G FL+R+SN G + LS+ + Sbjct: 123 NYVAPMETLEAEEWFYGPIKRPEAEKLLQSPPNEHGAFLIRDSN--KGLFALSMRDGDMI 180 Query: 436 VHYQIRRHGEDAFF 477 HY+IR+ FF Sbjct: 181 KHYRIRKSDTGGFF 194 >SB_6049| Best HMM Match : SH2 (HMM E-Value=8.4e-30) Length = 94 Score = 49.6 bits (113), Expect = 3e-06 Identities = 26/61 (42%), Positives = 35/61 (57%), Gaps = 1/61 (1%) Frame = +1 Query: 298 WFHGKISRESAEKLLKE-EGEDGVFLVRESNTSPGDYVLSVLHQGQVVHYQIRRHGEDAF 474 WF+G I R AEKLL+ E G FL+R+SN G + LS+ + HY+IR+ F Sbjct: 2 WFYGPIKRPEAEKLLQSPPNEHGAFLIRDSN--KGLFALSMRDGDMIKHYRIRKSDTGGF 59 Query: 475 F 477 F Sbjct: 60 F 60 >SB_10902| Best HMM Match : SH3_1 (HMM E-Value=0) Length = 824 Score = 44.4 bits (100), Expect = 1e-04 Identities = 20/35 (57%), Positives = 23/35 (65%) Frame = +1 Query: 289 NVNWFHGKISRESAEKLLKEEGEDGVFLVRESNTS 393 N WF G+ISR E+LL G DG FLVRES T+ Sbjct: 373 NQEWFWGRISRRQGEQLLLNHGTDGDFLVRESETT 407 >SB_51507| Best HMM Match : SH2 (HMM E-Value=2.3e-22) Length = 192 Score = 44.4 bits (100), Expect = 1e-04 Identities = 23/66 (34%), Positives = 36/66 (54%), Gaps = 4/66 (6%) Frame = +1 Query: 298 WFHGKISRESAEKLLKEEGEDGVFLV----RESNTSPGDYVLSVLHQGQVVHYQIRRHGE 465 W+H ++R +AE +LK +DG FLV R+ T Y +S + ++ H ++RR G Sbjct: 2 WYHDNLTRSAAEDMLKRVRKDGAFLVRRRERDDRTGEESYAISFRAEKKIKHCKLRREGR 61 Query: 466 DAFFSI 483 FSI Sbjct: 62 --LFSI 65 >SB_42044| Best HMM Match : ubiquitin (HMM E-Value=1.2e-06) Length = 1425 Score = 44.4 bits (100), Expect = 1e-04 Identities = 24/54 (44%), Positives = 33/54 (61%), Gaps = 1/54 (1%) Frame = +1 Query: 298 WFHGKISRESAEKLLKEEGEDGVFLVRESNTSPGDYVLSVLHQGQ-VVHYQIRR 456 WFHGKI+ E AE L++ GE FLVRE PG Y ++V ++ Q +H I + Sbjct: 318 WFHGKITAEYAEMLMRGAGE---FLVREDPAMPGMYFIAVRNKEQETLHLAITK 368 >SB_7592| Best HMM Match : PI-PLC-Y (HMM E-Value=1.1e-33) Length = 997 Score = 44.4 bits (100), Expect = 1e-04 Identities = 23/66 (34%), Positives = 36/66 (54%), Gaps = 4/66 (6%) Frame = +1 Query: 298 WFHGKISRESAEKLLKEEGEDGVFLV----RESNTSPGDYVLSVLHQGQVVHYQIRRHGE 465 W+H ++R +AE +LK +DG FLV R+ T Y +S + ++ H ++RR G Sbjct: 97 WYHDNLTRSAAEDMLKRVRKDGAFLVRRRERDDRTGEESYAISFRAEKKIKHCKLRREGR 156 Query: 466 DAFFSI 483 FSI Sbjct: 157 --LFSI 160 Score = 39.9 bits (89), Expect = 0.003 Identities = 22/42 (52%), Positives = 26/42 (61%), Gaps = 3/42 (7%) Frame = +1 Query: 298 WFHGKI--SRESAEKLLKEEGE-DGVFLVRESNTSPGDYVLS 414 WFHGK+ R AE+ L + DG FLVRES T GD+ LS Sbjct: 53 WFHGKLPDGRRVAEQYLNQFNRGDGSFLVRESTTFVGDFSLS 94 >SB_27771| Best HMM Match : SH2 (HMM E-Value=8.6e-16) Length = 896 Score = 38.7 bits (86), Expect = 0.006 Identities = 16/32 (50%), Positives = 22/32 (68%) Frame = +1 Query: 355 EDGVFLVRESNTSPGDYVLSVLHQGQVVHYQI 450 +DG FLVR S P DY +S+L++G V H +I Sbjct: 268 QDGAFLVRNSTRHPNDYSMSLLYKGDVRHLKI 299 >SB_34759| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 633 Score = 37.1 bits (82), Expect = 0.018 Identities = 19/55 (34%), Positives = 30/55 (54%) Frame = +1 Query: 253 ENSFLLRMNREDNVNWFHGKISRESAEKLLKEEGEDGVFLVRESNTSPGDYVLSV 417 E + R+N N W+ I RE ++L + E+G F VR+S + PG + L+V Sbjct: 486 EEEAVQRLNDHQNEYWYMPGIPREFIMEML-QASEEGSFFVRDSQSKPGCHALTV 539 >SB_17929| Best HMM Match : SH2 (HMM E-Value=5e-08) Length = 170 Score = 37.1 bits (82), Expect = 0.018 Identities = 19/55 (34%), Positives = 30/55 (54%) Frame = +1 Query: 253 ENSFLLRMNREDNVNWFHGKISRESAEKLLKEEGEDGVFLVRESNTSPGDYVLSV 417 E + R+N N W+ I RE ++L + E+G F VR+S + PG + L+V Sbjct: 23 EEEAVQRLNDHQNEYWYMPGIPREFIMEML-QASEEGSFFVRDSQSKPGCHALTV 76 >SB_58219| Best HMM Match : SOCS_box (HMM E-Value=2e-07) Length = 507 Score = 34.7 bits (76), Expect = 0.094 Identities = 23/67 (34%), Positives = 33/67 (49%), Gaps = 1/67 (1%) Frame = +1 Query: 289 NVNWFHGKISRESAEKLLKEEGEDGVFLVRESNTSPGDYVLSVLHQGQVVHYQ-IRRHGE 465 N W+ G +S + AEK L + DG FLVR+S +S +G H + I G+ Sbjct: 342 NCGWYWGPMSSKEAEKELYNQ-PDGCFLVRDSENDYHLLSVSFRSKGATCHTRLIYNKGK 400 Query: 466 DAFFSIE 486 +FF E Sbjct: 401 FSFFQDE 407 >SB_48515| Best HMM Match : SH2 (HMM E-Value=3.1) Length = 40 Score = 34.3 bits (75), Expect = 0.12 Identities = 19/39 (48%), Positives = 22/39 (56%) Frame = +1 Query: 301 FHGKISRESAEKLLKEEGEDGVFLVRESNTSPGDYVLSV 417 F GK+ R AE+ DG FLVRES G+Y LSV Sbjct: 2 FAGKMDRTEAEQETMGRS-DGTFLVRESANRAGEYALSV 39 >SB_30637| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1137 Score = 32.7 bits (71), Expect = 0.38 Identities = 12/27 (44%), Positives = 19/27 (70%) Frame = +1 Query: 355 EDGVFLVRESNTSPGDYVLSVLHQGQV 435 EDG F+VR+S PG+Y L+++ G + Sbjct: 393 EDGTFIVRDSKRFPGEYTLTLMKGGVI 419 Score = 31.5 bits (68), Expect = 0.88 Identities = 16/45 (35%), Positives = 28/45 (62%) Frame = +1 Query: 355 EDGVFLVRESNTSPGDYVLSVLHQGQVVHYQIRRHGEDAFFSIEE 489 EDG F+VR+S PG+Y L+++ + V+ ++ R ED F + + Sbjct: 361 EDGTFIVRDSKRFPGEYTLTLM---EAVNARM-RDTEDGTFIVRD 401 >SB_20077| Best HMM Match : zf-RanBP (HMM E-Value=0.24) Length = 346 Score = 32.3 bits (70), Expect = 0.50 Identities = 14/38 (36%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = +3 Query: 525 HYRSDSNGLVTRLSIVCKGE-PPPHESRTQGTTNLLHR 635 H +DSN L R+ CK PPP + +G N+ H+ Sbjct: 178 HSCNDSNALARRVCTTCKASFPPPKKKEMRGDGNITHQ 215 >SB_47880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 244 Score = 31.9 bits (69), Expect = 0.67 Identities = 14/38 (36%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = +3 Query: 525 HYRSDSNGLVTRLSIVCKGE-PPPHESRTQGTTNLLHR 635 H +DSN L R+ CK PPP + +G N+ H+ Sbjct: 70 HSCNDSNALARRVCTTCKAPFPPPKKKEMRGDGNITHQ 107 >SB_28180| Best HMM Match : Ank (HMM E-Value=1.5e-15) Length = 211 Score = 31.5 bits (68), Expect = 0.88 Identities = 14/39 (35%), Positives = 22/39 (56%) Frame = +3 Query: 588 PPHESRTQGTTNLLHRATEAGHFNVVSKLLGKRATGVAT 704 P H + +G T LH A+ +GH ++V LL + A + T Sbjct: 53 PLHLAAIEGNTTPLHLASRSGHVDMVELLLNRNANIILT 91 >SB_54309| Best HMM Match : SH2 (HMM E-Value=5.1e-17) Length = 1249 Score = 31.5 bits (68), Expect = 0.88 Identities = 19/51 (37%), Positives = 30/51 (58%) Frame = +1 Query: 298 WFHGKISRESAEKLLKEEGEDGVFLVRESNTSPGDYVLSVLHQGQVVHYQI 450 +FHG ISR+ AE++L ++ G FLVR S G Y ++ + + HY + Sbjct: 803 YFHGIISRQDAEQVLLDK-VPGSFLVRVSERVWG-YTITYRAEERCKHYLV 851 >SB_37681| Best HMM Match : SH2 (HMM E-Value=3.5e-11) Length = 421 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/32 (46%), Positives = 22/32 (68%) Frame = +1 Query: 289 NVNWFHGKISRESAEKLLKEEGEDGVFLVRES 384 N W+ GKI+R AE++L + DG FL+R+S Sbjct: 255 NCPWYWGKINRFEAERVL-DGLPDGTFLLRDS 285 >SB_5939| Best HMM Match : BAH (HMM E-Value=7.9e-18) Length = 1086 Score = 30.3 bits (65), Expect = 2.0 Identities = 21/74 (28%), Positives = 31/74 (41%) Frame = +1 Query: 421 HQGQVVHYQIRRHGEDAFFSIEEHTTVHGWILLYNITVVIQMDLLLGCPLSVKENHHRMS 600 H Q++H + HG A S+ H +L I +D + G P+ NHH S Sbjct: 841 HSYQLLHGRSLEHGAMAARSMASQAQAHEALLKNAAARGIPIDPVTGLPVGY-PNHHSHS 899 Query: 601 RGHREQQIYCTEQR 642 H I+ EQ+ Sbjct: 900 HMHTHFHIHPHEQQ 913 >SB_50497| Best HMM Match : CH (HMM E-Value=0.0084) Length = 2086 Score = 29.9 bits (64), Expect = 2.7 Identities = 17/57 (29%), Positives = 29/57 (50%) Frame = +1 Query: 601 RGHREQQIYCTEQRKRVISTWCRSYWASGLPESRRQETRTVRTAVHIAARAGRDXIL 771 RGHRE +++ + + + TWCR W +PE+ E+ V V GR+ ++ Sbjct: 737 RGHRESKLFHSRENVQKFLTWCR--W-HDIPEAILFESNDV-VLVDECRTGGREIVI 789 >SB_37909| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 29.9 bits (64), Expect = 2.7 Identities = 17/52 (32%), Positives = 24/52 (46%) Frame = +1 Query: 643 KRVISTWCRSYWASGLPESRRQETRTVRTAVHIAARAGRDXILAELHRXAAP 798 + VIS + + A P R ETRT + +H+A + RD A H P Sbjct: 16 RAVISDYAPTTLAVIWPHPTRLETRTKESNIHLARKTSRDYPCAYAHDTDQP 67 >SB_34518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 337 Score = 29.5 bits (63), Expect = 3.6 Identities = 19/50 (38%), Positives = 23/50 (46%) Frame = +1 Query: 691 PESRRQETRTVRTAVHIAARAGRDXILAELHRXAAPLSTFRDSFGLQRPF 840 P R+Q RT R+ H + D ILAE H AP S G+ PF Sbjct: 21 PRDRQQSRRTARSPPH-STTDREDGILAERHAPQAPRSALD---GVYHPF 66 >SB_19207| Best HMM Match : ig (HMM E-Value=1.2e-11) Length = 418 Score = 29.1 bits (62), Expect = 4.7 Identities = 12/44 (27%), Positives = 21/44 (47%) Frame = +1 Query: 547 DLLLGCPLSVKENHHRMSRGHREQQIYCTEQRKRVISTWCRSYW 678 + + G P+ HH+ + I T +R + +S+ CR YW Sbjct: 263 EFMYGSPVYATSRHHQRIIEGKLSGIISTLRRAKHVSSKCRKYW 306 >SB_14500| Best HMM Match : Vicilin_N (HMM E-Value=5.3) Length = 237 Score = 29.1 bits (62), Expect = 4.7 Identities = 16/40 (40%), Positives = 19/40 (47%) Frame = +1 Query: 691 PESRRQETRTVRTAVHIAARAGRDXILAELHRXAAPLSTF 810 P R+Q RT R+ H + D LAE H AP S F Sbjct: 120 PRDRQQSRRTARSPPH-STTDREDGTLAERHAPQAPRSVF 158 >SB_1337| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 221 Score = 29.1 bits (62), Expect = 4.7 Identities = 19/57 (33%), Positives = 25/57 (43%), Gaps = 3/57 (5%) Frame = -2 Query: 543 LNHYGNVV*EYPSMNSCVLFYREECIFTV---SAYLIMHYLTLMQNRQNIISRRSIT 382 +NHY +V YP +NS L R T S L+ HY L+ I S +T Sbjct: 88 VNHYSQLVNRYPKINSSSLVTRLPLSVTCYRHSPLLVNHYSQLVNRYPKINSSSLVT 144 >SB_56452| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 28.7 bits (61), Expect = 6.2 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 625 YCTEQRKRVISTWCRSYWASGL 690 YC RV TWC YW GL Sbjct: 15 YCVFGLLRVRVTWCSGYWVFGL 36 >SB_41671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 52 Score = 28.7 bits (61), Expect = 6.2 Identities = 16/38 (42%), Positives = 19/38 (50%) Frame = +1 Query: 691 PESRRQETRTVRTAVHIAARAGRDXILAELHRXAAPLS 804 P R+Q RT R+ H + D ILAE H AP S Sbjct: 15 PRDRQQSRRTARSPPH-STTDREDGILAERHAPQAPRS 51 >SB_31513| Best HMM Match : Transgly_assoc (HMM E-Value=0.49) Length = 340 Score = 28.7 bits (61), Expect = 6.2 Identities = 21/67 (31%), Positives = 31/67 (46%), Gaps = 1/67 (1%) Frame = +1 Query: 619 QIYCTEQRKRVISTWCRSYWASGLPESRRQETRTVRTAVHIAARAGR-DXILAELHRXAA 795 QI E+ K+ IS + +PE E RTVR +V R+G+ I +L A Sbjct: 106 QISTDERGKQFISFYSARKGGWTIPERLYNEDRTVRKSVDTKIRSGKYKQIQIQLDELDA 165 Query: 796 PLSTFRD 816 +T R+ Sbjct: 166 TANTLRE 172 >SB_25082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 585 Score = 28.7 bits (61), Expect = 6.2 Identities = 24/77 (31%), Positives = 35/77 (45%), Gaps = 5/77 (6%) Frame = +3 Query: 432 SSALSNTQTR*-RCI---LLYRRAHNCSWMDTLIQHYRSDSNGLVTRLSIVCKGEPPPHE 599 SSAL+ Q R +CI ++ AH W D + Y+ GL+ + I+ Sbjct: 286 SSALTALQAREDKCIPYAVITGEAHPLKWDDLIESSYKQGVKGLIQEVKILEHKSEYSKS 345 Query: 600 SRTQ-GTTNLLHRATEA 647 SRT + LL AT+A Sbjct: 346 SRTWFNSQRLLSMATDA 362 >SB_4447| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 770 Score = 28.7 bits (61), Expect = 6.2 Identities = 19/57 (33%), Positives = 25/57 (43%), Gaps = 3/57 (5%) Frame = -2 Query: 543 LNHYGNVV*EYPSMNSCVLFYREECIFT---VSAYLIMHYLTLMQNRQNIISRRSIT 382 +NHY +V YP +NS L R T S L+ HY L+ I S +T Sbjct: 368 VNHYSQLVNRYPKINSSSLVTRLPLSVTRYRHSPLLVNHYSQLVNRYPKINSSSPVT 424 Score = 28.3 bits (60), Expect = 8.2 Identities = 19/57 (33%), Positives = 25/57 (43%), Gaps = 3/57 (5%) Frame = -2 Query: 543 LNHYGNVV*EYPSMNSCVLFYREECIFT---VSAYLIMHYLTLMQNRQNIISRRSIT 382 +NHY +V YP +NS L R T S L+ HY L+ I S +T Sbjct: 332 VNHYSKLVNRYPKINSSSLVTRLPLSVTRYRHSPLLVNHYSQLVNRYPKINSSSLVT 388 >SB_53888| Best HMM Match : TSP_3 (HMM E-Value=9.2e-11) Length = 1012 Score = 28.7 bits (61), Expect = 6.2 Identities = 15/48 (31%), Positives = 22/48 (45%) Frame = +2 Query: 665 VEVTGQAGYRSRDAKKPGXSEPRCTSPRGXDETPSSPNSIEXRLHCQR 808 +++T G+ RD P S+ TSPR D +SP + L R Sbjct: 26 MDLTAGTGHSDRDQISPCDSDHDQTSPRDTDHDQTSPRDSDNALTTPR 73 >SB_49656| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 292 Score = 28.7 bits (61), Expect = 6.2 Identities = 16/38 (42%), Positives = 19/38 (50%) Frame = +1 Query: 691 PESRRQETRTVRTAVHIAARAGRDXILAELHRXAAPLS 804 P R+Q RT R+ H + D ILAE H AP S Sbjct: 188 PRDRQQSRRTARSPPH-STTDREDGILAERHAPQAPRS 224 >SB_30302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 28.7 bits (61), Expect = 6.2 Identities = 16/38 (42%), Positives = 19/38 (50%) Frame = +1 Query: 691 PESRRQETRTVRTAVHIAARAGRDXILAELHRXAAPLS 804 P R+Q RT R+ H + D ILAE H AP S Sbjct: 21 PRDRQQSRRTARSPPH-STTDREDGILAERHAPQAPRS 57 >SB_24557| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 28.7 bits (61), Expect = 6.2 Identities = 16/38 (42%), Positives = 19/38 (50%) Frame = +1 Query: 691 PESRRQETRTVRTAVHIAARAGRDXILAELHRXAAPLS 804 P R+Q RT R+ H + D ILAE H AP S Sbjct: 21 PRDRQQSRRTARSPPH-STTDREDGILAERHAPQAPRS 57 >SB_14435| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 234 Score = 28.7 bits (61), Expect = 6.2 Identities = 16/42 (38%), Positives = 19/42 (45%) Frame = +1 Query: 691 PESRRQETRTVRTAVHIAARAGRDXILAELHRXAAPLSTFRD 816 P R+Q RT R+ H + D LAE H AP S D Sbjct: 18 PRDRQQSRRTARSPPH-STTDREDGTLAERHAPQAPRSALTD 58 >SB_3849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 28.7 bits (61), Expect = 6.2 Identities = 16/38 (42%), Positives = 19/38 (50%) Frame = +1 Query: 691 PESRRQETRTVRTAVHIAARAGRDXILAELHRXAAPLS 804 P R+Q RT R+ H + D ILAE H AP S Sbjct: 21 PRDRQQSRRTARSPPH-STTDREDGILAERHAPQAPRS 57 >SB_33968| Best HMM Match : Transformer (HMM E-Value=5.1) Length = 471 Score = 28.3 bits (60), Expect = 8.2 Identities = 16/40 (40%), Positives = 18/40 (45%) Frame = +1 Query: 691 PESRRQETRTVRTAVHIAARAGRDXILAELHRXAAPLSTF 810 P R+Q RT R+ H D LAE H AP S F Sbjct: 169 PRDRQQSRRTARSPPHPTTDR-EDGTLAERHAPQAPRSVF 207 >SB_58795| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 28.3 bits (60), Expect = 8.2 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = -1 Query: 448 FDNALLDPDAKQTKHNLQAKYYSP 377 FD L+P K++ N+ KYY P Sbjct: 74 FDQQALEPSIKESMRNVLGKYYQP 97 >SB_9897| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 589 Score = 28.3 bits (60), Expect = 8.2 Identities = 13/51 (25%), Positives = 25/51 (49%) Frame = +1 Query: 580 ENHHRMSRGHREQQIYCTEQRKRVISTWCRSYWASGLPESRRQETRTVRTA 732 + H + R H+ CT+ ++ + T S ++ + RQ RTV+T+ Sbjct: 193 DRQHALYRPHQTDSALCTDSTRQTVRTVQTSPDSAHCTDLTRQTVRTVQTS 243 Score = 28.3 bits (60), Expect = 8.2 Identities = 13/51 (25%), Positives = 25/51 (49%) Frame = +1 Query: 580 ENHHRMSRGHREQQIYCTEQRKRVISTWCRSYWASGLPESRRQETRTVRTA 732 + H + R H+ CT+ ++ + T S ++ + RQ RTV+T+ Sbjct: 373 DRQHALYRPHQTDSALCTDSTRQTVRTVQTSPDSAHCTDLTRQTVRTVQTS 423 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,159,527 Number of Sequences: 59808 Number of extensions: 521346 Number of successful extensions: 1411 Number of sequences better than 10.0: 54 Number of HSP's better than 10.0 without gapping: 1239 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1391 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2371447782 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -