BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0958 (852 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock prote... 22 5.4 AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxida... 22 7.1 >EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock protein 90 protein. Length = 721 Score = 22.2 bits (45), Expect = 5.4 Identities = 8/29 (27%), Positives = 15/29 (51%) Frame = +3 Query: 129 VTIFKRNEENRSLALRTTPGGEMSVMQKR 215 VT+ +N ++ ++ GG +V Q R Sbjct: 141 VTVVSKNNDDEQYVWESSAGGSFTVTQDR 169 >AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxidase subunit 1 protein. Length = 682 Score = 21.8 bits (44), Expect = 7.1 Identities = 15/55 (27%), Positives = 22/55 (40%) Frame = +2 Query: 410 RTPLEAHQNGAETTRGQPAPPAHHTPTVGFTLHIHDLRLVQAFWLNMEAEETNMR 574 RTP+E Q+ + + A+ +G LH LV F E + N R Sbjct: 174 RTPIEIPQDFTASDLDEEHRVAYWREDIGLNLHHWHWHLVYPFEGAREIVDKNRR 228 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 169,725 Number of Sequences: 336 Number of extensions: 3233 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 23555563 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -