BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0955 (846 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_11683| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_59562| Best HMM Match : RRM_1 (HMM E-Value=6.1e-23) 50 2e-06 SB_11682| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_1585| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.014 SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) 36 0.031 SB_41412| Best HMM Match : RRM_1 (HMM E-Value=2.9e-35) 36 0.055 SB_44114| Best HMM Match : RRM_1 (HMM E-Value=9.9e-35) 35 0.095 SB_23537| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.095 SB_971| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.17 SB_41866| Best HMM Match : RRM_1 (HMM E-Value=0) 34 0.17 SB_29861| Best HMM Match : RRM_1 (HMM E-Value=1.10002e-42) 33 0.39 SB_51896| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.39 SB_48466| Best HMM Match : Pro_isomerase (HMM E-Value=0) 32 0.67 SB_2700| Best HMM Match : RRM_1 (HMM E-Value=0) 32 0.67 SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_45423| Best HMM Match : RRM_1 (HMM E-Value=0) 31 1.6 SB_1873| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_57434| Best HMM Match : LRR_1 (HMM E-Value=3.9e-13) 30 2.7 SB_53070| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_44482| Best HMM Match : RRM_1 (HMM E-Value=0.19) 30 2.7 SB_37198| Best HMM Match : RRM_1 (HMM E-Value=7.8e-23) 30 2.7 SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_11106| Best HMM Match : RRM_1 (HMM E-Value=1.8e-11) 30 2.7 SB_6474| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_2543| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_8450| Best HMM Match : RRM_1 (HMM E-Value=1.7e-36) 29 4.7 SB_27005| Best HMM Match : NTF2 (HMM E-Value=1.1e-33) 29 6.3 SB_51113| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_463| Best HMM Match : RRM_1 (HMM E-Value=3.3e-16) 29 6.3 SB_28089| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 >SB_11683| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 50.8 bits (116), Expect = 1e-06 Identities = 19/38 (50%), Positives = 27/38 (71%) Frame = +2 Query: 140 TRVYVGGLVEGIKKEDLEREFDKYGKLNSVWVALNPPG 253 +RVY+G + + K ++EREF+ +G L VWVA NPPG Sbjct: 2 SRVYIGNIGDNASKREIEREFETFGPLRDVWVARNPPG 39 Score = 32.3 bits (70), Expect = 0.51 Identities = 14/36 (38%), Positives = 23/36 (63%) Frame = +1 Query: 247 PRFAFIEFENLQEAEDACSAMNGTEMLGATLKVEIS 354 P FAF FE+ ++AEDA ++G + G +VE++ Sbjct: 38 PGFAFCVFEDRRDAEDAVRELDGRYICGQRARVELA 73 >SB_59562| Best HMM Match : RRM_1 (HMM E-Value=6.1e-23) Length = 201 Score = 50.4 bits (115), Expect = 2e-06 Identities = 20/38 (52%), Positives = 27/38 (71%) Frame = +2 Query: 140 TRVYVGGLVEGIKKEDLEREFDKYGKLNSVWVALNPPG 253 T++YVG L +LER F+K+G+L+ VWVA NPPG Sbjct: 4 TKLYVGNLGRNADSSELERAFEKFGRLSKVWVARNPPG 41 Score = 36.7 bits (81), Expect = 0.024 Identities = 14/36 (38%), Positives = 25/36 (69%) Frame = +1 Query: 247 PRFAFIEFENLQEAEDACSAMNGTEMLGATLKVEIS 354 P FAF+E+E+ ++AE+A ++G + T++VE S Sbjct: 40 PGFAFVEYEDYRDAEEAVRELDGANVCDRTIRVEFS 75 >SB_11682| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 50.0 bits (114), Expect = 2e-06 Identities = 20/38 (52%), Positives = 25/38 (65%) Frame = +2 Query: 140 TRVYVGGLVEGIKKEDLEREFDKYGKLNSVWVALNPPG 253 T+VY+G L + K ++E EF YG L VWVA NPPG Sbjct: 32 TKVYIGSLGDNASKREIENEFGYYGPLKDVWVARNPPG 69 Score = 31.5 bits (68), Expect = 0.89 Identities = 13/36 (36%), Positives = 24/36 (66%) Frame = +1 Query: 247 PRFAFIEFENLQEAEDACSAMNGTEMLGATLKVEIS 354 P FAF F++ ++AEDA ++G + G ++VE++ Sbjct: 68 PGFAFCIFDDRRDAEDAVRELDGRYICGQRVRVELA 103 >SB_1585| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 721 Score = 37.5 bits (83), Expect = 0.014 Identities = 14/32 (43%), Positives = 22/32 (68%) Frame = +1 Query: 253 FAFIEFENLQEAEDACSAMNGTEMLGATLKVE 348 +A +E+E +EA+ A A+NG EMLG + V+ Sbjct: 336 YALVEYETFKEAQSALEALNGAEMLGQNISVD 367 >SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) Length = 507 Score = 36.3 bits (80), Expect = 0.031 Identities = 16/34 (47%), Positives = 23/34 (67%) Frame = +1 Query: 247 PRFAFIEFENLQEAEDACSAMNGTEMLGATLKVE 348 P FAF+EFE+ ++AEDA +G E G ++VE Sbjct: 300 PPFAFVEFEDPRDAEDAVKGRDGHEFDGYRIRVE 333 Score = 31.5 bits (68), Expect = 0.89 Identities = 14/34 (41%), Positives = 21/34 (61%) Frame = +2 Query: 128 SSGGTRVYVGGLVEGIKKEDLEREFDKYGKLNSV 229 +S RVYVG L + ++++DL F KYG + V Sbjct: 257 NSNDCRVYVGNLPQDVREKDLHDIFYKYGHIADV 290 >SB_41412| Best HMM Match : RRM_1 (HMM E-Value=2.9e-35) Length = 1118 Score = 35.5 bits (78), Expect = 0.055 Identities = 16/34 (47%), Positives = 23/34 (67%) Frame = +1 Query: 253 FAFIEFENLQEAEDACSAMNGTEMLGATLKVEIS 354 + F+EFE+ ++A+DA NG EMLG + VE S Sbjct: 38 YGFVEFEDDRDADDAVYECNGKEMLGERILVEHS 71 Score = 29.5 bits (63), Expect = 3.6 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = +2 Query: 143 RVYVGGLVEGIKKEDLEREFDKYGKLNSV 229 RVY+G L G ++D+ R F YG+L + Sbjct: 4 RVYLGRLPYGTTEDDVRRFFRSYGRLRDI 32 >SB_44114| Best HMM Match : RRM_1 (HMM E-Value=9.9e-35) Length = 929 Score = 34.7 bits (76), Expect = 0.095 Identities = 13/34 (38%), Positives = 24/34 (70%) Frame = +1 Query: 253 FAFIEFENLQEAEDACSAMNGTEMLGATLKVEIS 354 + F+EF++ ++AEDA +NG +++G + VE S Sbjct: 724 YGFVEFDDHRDAEDAVHDLNGRDLIGERVVVEFS 757 >SB_23537| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 371 Score = 34.7 bits (76), Expect = 0.095 Identities = 14/35 (40%), Positives = 23/35 (65%) Frame = +1 Query: 241 KSPRFAFIEFENLQEAEDACSAMNGTEMLGATLKV 345 +S F F+ F N ++A+ A ++NG E+ G TLK+ Sbjct: 97 RSRGFGFVTFANPEDAQTAVKSLNGKEVQGRTLKI 131 >SB_971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 783 Score = 33.9 bits (74), Expect = 0.17 Identities = 14/30 (46%), Positives = 21/30 (70%) Frame = +2 Query: 140 TRVYVGGLVEGIKKEDLEREFDKYGKLNSV 229 TR++VGGL I +LEREFD++G + + Sbjct: 318 TRLWVGGLGPWISIPELEREFDRFGAIRRI 347 >SB_41866| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 718 Score = 33.9 bits (74), Expect = 0.17 Identities = 15/33 (45%), Positives = 21/33 (63%) Frame = +1 Query: 241 KSPRFAFIEFENLQEAEDACSAMNGTEMLGATL 339 KS F F+ FE +EAE+A + +NG E+ G L Sbjct: 147 KSKGFGFVSFETPEEAEEAVNVLNGKEIGGRRL 179 >SB_29861| Best HMM Match : RRM_1 (HMM E-Value=1.10002e-42) Length = 1531 Score = 32.7 bits (71), Expect = 0.39 Identities = 12/28 (42%), Positives = 21/28 (75%) Frame = +2 Query: 146 VYVGGLVEGIKKEDLEREFDKYGKLNSV 229 ++VG L E I++ED+ + F +YG++ SV Sbjct: 8 LWVGNLPENIREEDIVKHFTRYGRVESV 35 Score = 30.3 bits (65), Expect = 2.1 Identities = 9/28 (32%), Positives = 19/28 (67%) Frame = +2 Query: 146 VYVGGLVEGIKKEDLEREFDKYGKLNSV 229 ++VGG+ + ++ +ER F +YG++ V Sbjct: 330 IWVGGVTNSLSEQQVERHFGRYGRVTKV 357 >SB_51896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 32.7 bits (71), Expect = 0.39 Identities = 16/32 (50%), Positives = 21/32 (65%) Frame = +2 Query: 125 MSSGGTRVYVGGLVEGIKKEDLEREFDKYGKL 220 M+S GT+++VG L + K DLE F YGKL Sbjct: 1 MASRGTQLFVGRLSKETKLRDLENVFYLYGKL 32 >SB_48466| Best HMM Match : Pro_isomerase (HMM E-Value=0) Length = 298 Score = 31.9 bits (69), Expect = 0.67 Identities = 13/40 (32%), Positives = 24/40 (60%) Frame = +1 Query: 235 STKSPRFAFIEFENLQEAEDACSAMNGTEMLGATLKVEIS 354 ++K F F+EFE ++ A MN +E+ G T++V ++ Sbjct: 42 TSKHRGFGFVEFEFAEDTAAAIDNMNESELFGRTIRVNLA 81 >SB_2700| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 593 Score = 31.9 bits (69), Expect = 0.67 Identities = 15/35 (42%), Positives = 22/35 (62%) Frame = +1 Query: 241 KSPRFAFIEFENLQEAEDACSAMNGTEMLGATLKV 345 K + FIE+EN Q A DA ++MN ++ G L+V Sbjct: 238 KHKGYGFIEYENQQSANDAIASMNLFDLGGQFLRV 272 >SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 364 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/37 (40%), Positives = 24/37 (64%), Gaps = 1/37 (2%) Frame = +1 Query: 238 TKSPR-FAFIEFENLQEAEDACSAMNGTEMLGATLKV 345 T+ PR FAF+ F + + EDA + ++G E G ++KV Sbjct: 266 TQRPRGFAFVTFGSKKNMEDAINELDGQEFDGRSMKV 302 >SB_45423| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 514 Score = 30.7 bits (66), Expect = 1.6 Identities = 12/37 (32%), Positives = 21/37 (56%) Frame = +1 Query: 235 STKSPRFAFIEFENLQEAEDACSAMNGTEMLGATLKV 345 + +S + F++F + A+ A MNG E+ G LK+ Sbjct: 279 TNRSKGYGFVQFREAEAAKRAMEQMNGFELAGRPLKI 315 >SB_1873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 389 Score = 30.3 bits (65), Expect = 2.1 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = +1 Query: 253 FAFIEFENLQEAEDACSAMNGTEMLGATLKVEIS 354 +AF+ ++N +A A MNG + TLKV + Sbjct: 70 YAFVNYDNPDDANKAVREMNGARLQNKTLKVSFA 103 >SB_57434| Best HMM Match : LRR_1 (HMM E-Value=3.9e-13) Length = 337 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/28 (46%), Positives = 20/28 (71%) Frame = +2 Query: 146 VYVGGLVEGIKKEDLEREFDKYGKLNSV 229 V+VG L +KK+ L++ F KYG++ SV Sbjct: 23 VFVGNLPLTLKKKALKKYFSKYGEVESV 50 >SB_53070| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 347 Score = 29.9 bits (64), Expect = 2.7 Identities = 11/33 (33%), Positives = 21/33 (63%) Frame = +1 Query: 253 FAFIEFENLQEAEDACSAMNGTEMLGATLKVEI 351 F F+ ++N+ A++A MNG ++ LKV++ Sbjct: 305 FGFVSYDNVMSAQNAIQHMNGFQIGAKRLKVQL 337 >SB_44482| Best HMM Match : RRM_1 (HMM E-Value=0.19) Length = 486 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = +2 Query: 146 VYVGGLVEGIKKEDLEREFDKYGKLNSVWVALNPPGS 256 VYVG + + K+D+ R F KYG + V V G+ Sbjct: 372 VYVGKISDETHKDDVWRRFRKYGPIEKVTVHFRDNGN 408 >SB_37198| Best HMM Match : RRM_1 (HMM E-Value=7.8e-23) Length = 362 Score = 29.9 bits (64), Expect = 2.7 Identities = 11/33 (33%), Positives = 21/33 (63%) Frame = +1 Query: 253 FAFIEFENLQEAEDACSAMNGTEMLGATLKVEI 351 F F+ ++N+ A++A MNG ++ LKV++ Sbjct: 320 FGFVSYDNVMSAQNAIQHMNGFQIGAKRLKVQL 352 >SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 550 Score = 29.9 bits (64), Expect = 2.7 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = +2 Query: 140 TRVYVGGLVEGIKKEDLEREFDKYGKLNSV 229 T +YVGGL + ++DL F ++G+L S+ Sbjct: 304 TTLYVGGLEGKVTEQDLRDHFYQFGELRSI 333 >SB_11106| Best HMM Match : RRM_1 (HMM E-Value=1.8e-11) Length = 67 Score = 29.9 bits (64), Expect = 2.7 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +1 Query: 253 FAFIEFENLQEAEDACSAMNGTEMLG 330 + F+EF+ +AEDA NG +MLG Sbjct: 40 YGFVEFDYSDDAEDAVYECNGKKMLG 65 >SB_6474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 375 Score = 29.9 bits (64), Expect = 2.7 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = +2 Query: 128 SSGGTRVYVGGLVEGIKKEDLEREFDKYG 214 S+ +V++GGL G +EDL+ F YG Sbjct: 198 SANDGKVFIGGLAFGTTEEDLKEYFSTYG 226 >SB_2543| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 215 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/33 (42%), Positives = 22/33 (66%) Frame = +1 Query: 256 AFIEFENLQEAEDACSAMNGTEMLGATLKVEIS 354 AFI F + Q A++A +A+N +M G T+K I+ Sbjct: 54 AFILFIDRQSAQNAVAAVNKKQMFGRTIKCTIA 86 Score = 29.5 bits (63), Expect = 3.6 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = +2 Query: 146 VYVGGLVEGIKKEDLEREFDKYGKLNSVWV 235 VYVG L + DL + F++YGK+ V + Sbjct: 12 VYVGNLPYSLTNSDLHKVFERYGKVVKVTI 41 >SB_8450| Best HMM Match : RRM_1 (HMM E-Value=1.7e-36) Length = 328 Score = 29.1 bits (62), Expect = 4.7 Identities = 13/34 (38%), Positives = 21/34 (61%) Frame = +2 Query: 143 RVYVGGLVEGIKKEDLEREFDKYGKLNSVWVALN 244 +++VGGL KE L+ F KYG+L V + ++ Sbjct: 30 KLFVGGLSYETTKESLKEYFSKYGELVGVDIKMD 63 >SB_27005| Best HMM Match : NTF2 (HMM E-Value=1.1e-33) Length = 662 Score = 28.7 bits (61), Expect = 6.3 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +2 Query: 143 RVYVGGLVEGIKKEDLEREFDKYGKL 220 +V++G L G+K D+ F KYG + Sbjct: 358 QVFIGNLPSGVKDADVNEVFSKYGTI 383 >SB_51113| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 871 Score = 28.7 bits (61), Expect = 6.3 Identities = 11/31 (35%), Positives = 20/31 (64%) Frame = +1 Query: 253 FAFIEFENLQEAEDACSAMNGTEMLGATLKV 345 FAF+++ +EAE A NG ++ G+ ++V Sbjct: 249 FAFVDYATAEEAEKGQRAHNGRQVEGSNIRV 279 >SB_463| Best HMM Match : RRM_1 (HMM E-Value=3.3e-16) Length = 842 Score = 28.7 bits (61), Expect = 6.3 Identities = 8/27 (29%), Positives = 20/27 (74%) Frame = +2 Query: 143 RVYVGGLVEGIKKEDLEREFDKYGKLN 223 ++++GGL +ED+++ F ++GK++ Sbjct: 184 KIFIGGLSTNTSEEDMKKYFSQFGKVS 210 >SB_28089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 254 Score = 28.3 bits (60), Expect = 8.3 Identities = 9/26 (34%), Positives = 18/26 (69%) Frame = +1 Query: 253 FAFIEFENLQEAEDACSAMNGTEMLG 330 + F+EF++ ++A+D +NG +LG Sbjct: 40 YGFVEFDDYRDADDCVYDLNGRNLLG 65 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,995,889 Number of Sequences: 59808 Number of extensions: 311602 Number of successful extensions: 735 Number of sequences better than 10.0: 30 Number of HSP's better than 10.0 without gapping: 665 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 735 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2395401800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -