BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0955 (846 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g23860.2 68414.m03010 splicing factor RSZp21 (RSZP21) / 9G8-l... 46 4e-05 At1g23860.1 68414.m03009 splicing factor RSZp21 (RSZP21) / 9G8-l... 46 4e-05 At2g24590.1 68415.m02936 splicing factor, putative similar to to... 44 1e-04 At4g31580.1 68417.m04485 splicing factor RSZp22 (RSZP22) / 9G8-l... 44 2e-04 At1g09140.1 68414.m01018 SF2/ASF-like splicing modulator (SRP30)... 36 0.034 At3g49430.1 68416.m05403 pre-mRNA splicing factor, putative stro... 36 0.045 At3g23900.1 68416.m03003 RNA recognition motif (RRM)-containing ... 36 0.045 At1g51510.1 68414.m05797 RNA-binding protein, putative similar t... 36 0.045 At1g02840.3 68414.m00246 pre-mRNA splicing factor SF2 (SF2) / SR... 36 0.045 At1g02840.2 68414.m00244 pre-mRNA splicing factor SF2 (SF2) / SR... 36 0.045 At1g02840.1 68414.m00245 pre-mRNA splicing factor SF2 (SF2) / SR... 36 0.045 At3g53500.2 68416.m05907 zinc knuckle (CCHC-type) family protein... 35 0.059 At2g37340.1 68415.m04581 splicing factor RSZ33 (RSZ33) nearly id... 35 0.059 At4g02430.2 68417.m00330 pre-mRNA splicing factor, putative / SR... 35 0.078 At4g02430.1 68417.m00329 pre-mRNA splicing factor, putative / SR... 35 0.078 At2g43410.1 68415.m05395 RNA recognition motif (RRM)-containing ... 34 0.14 At5g58130.1 68418.m07273 RNA recognition motif (RRM)-containing ... 33 0.18 At4g35785.2 68417.m05083 transformer serine/arginine-rich ribonu... 33 0.24 At4g35785.1 68417.m05082 transformer serine/arginine-rich ribonu... 33 0.24 At3g52380.1 68416.m05757 33 kDa ribonucleoprotein, chloroplast, ... 33 0.24 At5g04280.1 68418.m00421 glycine-rich RNA-binding protein 33 0.32 At3g26420.1 68416.m03295 glycine-rich RNA-binding protein simila... 33 0.32 At1g22760.1 68414.m02844 polyadenylate-binding protein 3 (PABP3) 33 0.32 At1g07350.2 68414.m00784 transformer serine/arginine-rich ribonu... 33 0.32 At1g07350.1 68414.m00783 transformer serine/arginine-rich ribonu... 33 0.32 At2g42890.2 68415.m05312 RNA recognition motif (RRM)-containing ... 32 0.42 At2g42890.1 68415.m05311 RNA recognition motif (RRM)-containing ... 32 0.42 At2g35410.1 68415.m04340 33 kDa ribonucleoprotein, chloroplast, ... 32 0.42 At1g60650.2 68414.m06828 glycine-rich RNA-binding protein, putat... 32 0.42 At1g60650.1 68414.m06827 glycine-rich RNA-binding protein, putat... 32 0.42 At5g04600.1 68418.m00460 RNA recognition motif (RRM)-containing ... 32 0.55 At3g47120.1 68416.m05116 RNA recognition motif (RRM)-containing ... 32 0.55 At1g47490.1 68414.m05270 RNA-binding protein 47 (RBP47), putativ... 32 0.55 At1g20880.1 68414.m02615 RNA recognition motif (RRM)-containing ... 32 0.55 At4g34110.1 68417.m04839 polyadenylate-binding protein 2 (PABP2)... 31 0.73 At2g16940.1 68415.m01952 RNA recognition motif (RRM)-containing ... 31 0.73 At1g47500.1 68414.m05272 RNA-binding protein 47 (RBP47), putativ... 31 0.73 At1g03457.2 68414.m00327 RNA-binding protein, putative similar t... 31 0.73 At1g03457.1 68414.m00326 RNA-binding protein, putative similar t... 31 0.73 At3g61860.1 68416.m06947 arginine/serine-rich splicing factor RS... 31 0.96 At4g18120.1 68417.m02694 RNA recognition motif (RRM)-containing ... 30 1.7 At3g52150.1 68416.m05724 RNA recognition motif (RRM)-containing ... 30 1.7 At2g44710.1 68415.m05564 RNA recognition motif (RRM)-containing ... 30 1.7 At5g47330.1 68418.m05834 palmitoyl protein thioesterase family p... 30 2.2 At3g08000.1 68416.m00977 RNA-binding protein, putative similar t... 30 2.2 At1g71770.1 68414.m08295 polyadenylate-binding protein 5 (PABP5)... 30 2.2 At1g67550.1 68414.m07696 urease, putative / urea amidohydrolase,... 30 2.2 At1g60000.1 68414.m06759 29 kDa ribonucleoprotein, chloroplast, ... 30 2.2 At1g49760.1 68414.m05580 polyadenylate-binding protein, putative... 30 2.2 At1g29400.2 68414.m03597 RNA recognition motif (RRM)-containing ... 30 2.2 At1g29400.1 68414.m03596 RNA recognition motif (RRM)-containing ... 30 2.2 At1g13690.1 68414.m01609 RNA recognition motif (RRM)-containing ... 30 2.2 At5g06210.1 68418.m00693 RNA-binding protein, putative contains ... 29 2.9 At4g32720.1 68417.m04657 RNA recognition motif (RRM)-containing ... 29 2.9 At4g19610.1 68417.m02881 RNA recognition motif (RRM)-containing ... 29 2.9 At4g13860.1 68417.m02147 glycine-rich RNA-binding protein, putat... 29 2.9 At2g23350.1 68415.m02788 polyadenylate-binding protein, putative... 29 2.9 At1g76460.1 68414.m08893 RNA recognition motif (RRM)-containing ... 29 2.9 At5g55550.3 68418.m06922 RNA recognition motif (RRM)-containing ... 29 3.9 At5g55550.2 68418.m06921 RNA recognition motif (RRM)-containing ... 29 3.9 At5g55550.1 68418.m06920 RNA recognition motif (RRM)-containing ... 29 3.9 At5g46840.1 68418.m05771 RNA recognition motif (RRM)-containing ... 29 3.9 At5g19960.1 68418.m02376 RNA recognition motif (RRM)-containing ... 29 3.9 At3g53500.1 68416.m05906 zinc knuckle (CCHC-type) family protein... 29 3.9 At2g37340.3 68415.m04580 splicing factor RSZ33 (RSZ33) nearly id... 29 3.9 At1g49600.1 68414.m05561 RNA-binding protein 47 (RBP47), putativ... 29 3.9 At1g34140.1 68414.m04235 polyadenylate-binding protein, putative... 29 3.9 At5g59860.1 68418.m07506 RNA recognition motif (RRM)-containing ... 29 5.1 At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP... 29 5.1 At4g39260.3 68417.m05559 glycine-rich RNA-binding protein 8 (GRP... 29 5.1 At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP... 29 5.1 At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP... 29 5.1 At4g36690.3 68417.m05206 U2 snRNP auxiliary factor large subunit... 29 5.1 At4g36690.2 68417.m05207 U2 snRNP auxiliary factor large subunit... 29 5.1 At4g36690.1 68417.m05205 U2 snRNP auxiliary factor large subunit... 29 5.1 At4g03110.1 68417.m00420 RNA-binding protein, putative similar t... 29 5.1 At3g53460.2 68416.m05901 29 kDa ribonucleoprotein, chloroplast /... 28 6.8 At3g53460.1 68416.m05900 29 kDa ribonucleoprotein, chloroplast /... 28 6.8 At1g22330.1 68414.m02793 RNA recognition motif (RRM)-containing ... 28 6.8 At1g05510.1 68414.m00563 expressed protein 28 6.8 At5g59950.3 68418.m07518 RNA and export factor-binding protein, ... 28 9.0 At5g59950.2 68418.m07519 RNA and export factor-binding protein, ... 28 9.0 At5g59950.1 68418.m07517 RNA and export factor-binding protein, ... 28 9.0 At5g09880.1 68418.m01142 RNA recognition motif (RRM)-containing ... 28 9.0 At5g07060.1 68418.m00799 zinc finger (CCCH-type) family protein ... 28 9.0 At3g14100.1 68416.m01782 oligouridylate-binding protein, putativ... 28 9.0 At1g54080.2 68414.m06163 oligouridylate-binding protein, putativ... 28 9.0 At1g54080.1 68414.m06162 oligouridylate-binding protein, putativ... 28 9.0 >At1g23860.2 68414.m03010 splicing factor RSZp21 (RSZP21) / 9G8-like SR protein (SRZ21) nearly identical to 9G8-like splicing factor SRZ21 [Arabidopsis thaliana] GI:3435096, RSZp21 protein [Arabidopsis thaliana] GI:2582643 Length = 187 Score = 45.6 bits (103), Expect = 4e-05 Identities = 20/38 (52%), Positives = 25/38 (65%) Frame = +2 Query: 140 TRVYVGGLVEGIKKEDLEREFDKYGKLNSVWVALNPPG 253 TRVYVG L + + +LE EF +G L +VWVA PPG Sbjct: 2 TRVYVGNLDPRVTERELEDEFKAFGVLRNVWVARRPPG 39 >At1g23860.1 68414.m03009 splicing factor RSZp21 (RSZP21) / 9G8-like SR protein (SRZ21) nearly identical to 9G8-like splicing factor SRZ21 [Arabidopsis thaliana] GI:3435096, RSZp21 protein [Arabidopsis thaliana] GI:2582643 Length = 187 Score = 45.6 bits (103), Expect = 4e-05 Identities = 20/38 (52%), Positives = 25/38 (65%) Frame = +2 Query: 140 TRVYVGGLVEGIKKEDLEREFDKYGKLNSVWVALNPPG 253 TRVYVG L + + +LE EF +G L +VWVA PPG Sbjct: 2 TRVYVGNLDPRVTERELEDEFKAFGVLRNVWVARRPPG 39 >At2g24590.1 68415.m02936 splicing factor, putative similar to to RSZp22 protein [Arabidopsis thaliana] gi|2582645|emb|CAA05352 Length = 196 Score = 44.4 bits (100), Expect = 1e-04 Identities = 19/38 (50%), Positives = 25/38 (65%) Frame = +2 Query: 140 TRVYVGGLVEGIKKEDLEREFDKYGKLNSVWVALNPPG 253 +RVYVG L + + +LE EF +G + SVWVA PPG Sbjct: 2 SRVYVGNLDPRVTERELEDEFRSFGVIRSVWVARRPPG 39 >At4g31580.1 68417.m04485 splicing factor RSZp22 (RSZP22) / 9G8-like SR protein (SRZ22) identical to RSZp22 protein [Arabidopsis thaliana] gi|2582645|emb|CAA05352, 9G8-like SR protein [Arabidopsis thaliana] GI:3435094; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) and PF00098: Zinc knuckle; identical to cDNA 9G8-like SR protein (SRZ22) GI:3435093 Length = 200 Score = 43.6 bits (98), Expect = 2e-04 Identities = 19/38 (50%), Positives = 25/38 (65%) Frame = +2 Query: 140 TRVYVGGLVEGIKKEDLEREFDKYGKLNSVWVALNPPG 253 +RVYVG L + + +LE EF +G + SVWVA PPG Sbjct: 2 SRVYVGNLDPRVTERELEDEFRAFGVVRSVWVARRPPG 39 Score = 28.3 bits (60), Expect = 6.8 Identities = 10/25 (40%), Positives = 19/25 (76%) Frame = +1 Query: 241 KSPRFAFIEFENLQEAEDACSAMNG 315 + P +AF++FE+ ++A DA A++G Sbjct: 36 RPPGYAFLDFEDPRDARDAIRALDG 60 >At1g09140.1 68414.m01018 SF2/ASF-like splicing modulator (SRP30) nearly identical to SF2/ASF-like splicing modulator Srp30 [Arabidopsis thaliana] GI:4775270 Length = 268 Score = 35.9 bits (79), Expect = 0.034 Identities = 15/38 (39%), Positives = 26/38 (68%) Frame = +1 Query: 241 KSPRFAFIEFENLQEAEDACSAMNGTEMLGATLKVEIS 354 + P +AF+EFE+ ++A+DA +G + G L+VEI+ Sbjct: 43 RPPGYAFVEFEDPRDADDAIYGRDGYDFDGCRLRVEIA 80 Score = 27.9 bits (59), Expect = 9.0 Identities = 18/46 (39%), Positives = 26/46 (56%), Gaps = 3/46 (6%) Frame = +2 Query: 125 MSSGGTR-VYVGGLVEGIKKEDLEREFDKYGKLNSVWVAL--NPPG 253 MSS R +YVG L I+K ++E F KYG + + + + PPG Sbjct: 1 MSSRWNRTIYVGNLPGDIRKCEVEDLFYKYGPIVDIDLKIPPRPPG 46 >At3g49430.1 68416.m05403 pre-mRNA splicing factor, putative strong similarity to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 300 Score = 35.5 bits (78), Expect = 0.045 Identities = 14/38 (36%), Positives = 25/38 (65%) Frame = +1 Query: 241 KSPRFAFIEFENLQEAEDACSAMNGTEMLGATLKVEIS 354 + P + F+EFE+ ++AEDA +G + G L+VE++ Sbjct: 43 RPPCYCFVEFEHSRDAEDAIKGRDGYNLDGCRLRVELA 80 >At3g23900.1 68416.m03003 RNA recognition motif (RRM)-containing protein Length = 987 Score = 35.5 bits (78), Expect = 0.045 Identities = 19/46 (41%), Positives = 26/46 (56%) Frame = +1 Query: 217 TKLSLGSTKSPRFAFIEFENLQEAEDACSAMNGTEMLGATLKVEIS 354 T + T S A+IE+ N +EA A A+N TE+ G L VEI+ Sbjct: 376 TVVDCSITDSKHIAYIEYSNSEEAT-AALALNNTEVFGRALNVEIA 420 >At1g51510.1 68414.m05797 RNA-binding protein, putative similar to RNA-binding protein 8 (Ribonucleoprotein RBM8) SP:Q9Y5S9 from [Homo sapiens], RNA-binding protein Y14 [Xenopus laevis] GI:11034807; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 202 Score = 35.5 bits (78), Expect = 0.045 Identities = 15/32 (46%), Positives = 22/32 (68%) Frame = +1 Query: 253 FAFIEFENLQEAEDACSAMNGTEMLGATLKVE 348 +A IE+E +EA+ A SAMNG E+L + V+ Sbjct: 138 YALIEYEKKEEAQSAISAMNGAELLTQNVSVD 169 >At1g02840.3 68414.m00246 pre-mRNA splicing factor SF2 (SF2) / SR1 protein identical to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 303 Score = 35.5 bits (78), Expect = 0.045 Identities = 14/38 (36%), Positives = 26/38 (68%) Frame = +1 Query: 241 KSPRFAFIEFENLQEAEDACSAMNGTEMLGATLKVEIS 354 + P +AF+EF++ ++AEDA +G + G L+VE++ Sbjct: 43 RPPGYAFVEFDDARDAEDAIHGRDGYDFDGHRLRVELA 80 Score = 29.9 bits (64), Expect = 2.2 Identities = 19/46 (41%), Positives = 26/46 (56%), Gaps = 3/46 (6%) Frame = +2 Query: 125 MSSGGTR-VYVGGLVEGIKKEDLEREFDKYGKLNSV--WVALNPPG 253 MSS +R VYVG L I++ ++E F KYG + + V PPG Sbjct: 1 MSSRSSRTVYVGNLPGDIREREVEDLFSKYGPVVQIDLKVPPRPPG 46 >At1g02840.2 68414.m00244 pre-mRNA splicing factor SF2 (SF2) / SR1 protein identical to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 285 Score = 35.5 bits (78), Expect = 0.045 Identities = 14/38 (36%), Positives = 26/38 (68%) Frame = +1 Query: 241 KSPRFAFIEFENLQEAEDACSAMNGTEMLGATLKVEIS 354 + P +AF+EF++ ++AEDA +G + G L+VE++ Sbjct: 43 RPPGYAFVEFDDARDAEDAIHGRDGYDFDGHRLRVELA 80 Score = 29.9 bits (64), Expect = 2.2 Identities = 19/46 (41%), Positives = 26/46 (56%), Gaps = 3/46 (6%) Frame = +2 Query: 125 MSSGGTR-VYVGGLVEGIKKEDLEREFDKYGKLNSV--WVALNPPG 253 MSS +R VYVG L I++ ++E F KYG + + V PPG Sbjct: 1 MSSRSSRTVYVGNLPGDIREREVEDLFSKYGPVVQIDLKVPPRPPG 46 >At1g02840.1 68414.m00245 pre-mRNA splicing factor SF2 (SF2) / SR1 protein identical to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 303 Score = 35.5 bits (78), Expect = 0.045 Identities = 14/38 (36%), Positives = 26/38 (68%) Frame = +1 Query: 241 KSPRFAFIEFENLQEAEDACSAMNGTEMLGATLKVEIS 354 + P +AF+EF++ ++AEDA +G + G L+VE++ Sbjct: 43 RPPGYAFVEFDDARDAEDAIHGRDGYDFDGHRLRVELA 80 Score = 29.9 bits (64), Expect = 2.2 Identities = 19/46 (41%), Positives = 26/46 (56%), Gaps = 3/46 (6%) Frame = +2 Query: 125 MSSGGTR-VYVGGLVEGIKKEDLEREFDKYGKLNSV--WVALNPPG 253 MSS +R VYVG L I++ ++E F KYG + + V PPG Sbjct: 1 MSSRSSRTVYVGNLPGDIREREVEDLFSKYGPVVQIDLKVPPRPPG 46 >At3g53500.2 68416.m05907 zinc knuckle (CCHC-type) family protein contains Pfam domain PF00098: Zinc knuckle Length = 284 Score = 35.1 bits (77), Expect = 0.059 Identities = 15/32 (46%), Positives = 20/32 (62%) Frame = +2 Query: 134 GGTRVYVGGLVEGIKKEDLEREFDKYGKLNSV 229 G TR+YVG L + DLER F +YG++ V Sbjct: 9 GNTRLYVGRLSSRTRTRDLERLFSRYGRVRDV 40 Score = 29.1 bits (62), Expect = 3.9 Identities = 12/34 (35%), Positives = 23/34 (67%) Frame = +1 Query: 253 FAFIEFENLQEAEDACSAMNGTEMLGATLKVEIS 354 +AF+EF + ++A+DA ++G + G+ + VE S Sbjct: 46 YAFVEFSDPRDADDARYYLDGRDFDGSRITVEAS 79 >At2g37340.1 68415.m04581 splicing factor RSZ33 (RSZ33) nearly identical to splicing factor RSZ33 [Arabidopsis thaliana] GI:9843663; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF00098: Zinc knuckle Length = 290 Score = 35.1 bits (77), Expect = 0.059 Identities = 15/32 (46%), Positives = 20/32 (62%) Frame = +2 Query: 134 GGTRVYVGGLVEGIKKEDLEREFDKYGKLNSV 229 G TR+YVG L + DLER F +YG++ V Sbjct: 9 GNTRLYVGRLSSRTRTRDLERLFSRYGRVRDV 40 Score = 29.1 bits (62), Expect = 3.9 Identities = 12/34 (35%), Positives = 23/34 (67%) Frame = +1 Query: 253 FAFIEFENLQEAEDACSAMNGTEMLGATLKVEIS 354 +AF+EF + ++A+DA ++G + G+ + VE S Sbjct: 46 YAFVEFGDPRDADDARHYLDGRDFDGSRITVEFS 79 >At4g02430.2 68417.m00330 pre-mRNA splicing factor, putative / SR1 protein, putative strong similarity to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana}; cDNA NCBI_gi:15810292 supports a truncated version while protein evidence supports a longer model. Length = 278 Score = 34.7 bits (76), Expect = 0.078 Identities = 14/38 (36%), Positives = 26/38 (68%) Frame = +1 Query: 241 KSPRFAFIEFENLQEAEDACSAMNGTEMLGATLKVEIS 354 + P +AF+EFE+ ++A+DA +G + G L+VE++ Sbjct: 43 RPPGYAFVEFEDARDADDAIYGRDGYDFDGHHLRVELA 80 Score = 29.9 bits (64), Expect = 2.2 Identities = 17/46 (36%), Positives = 27/46 (58%), Gaps = 3/46 (6%) Frame = +2 Query: 125 MSSGGTR-VYVGGLVEGIKKEDLEREFDKYGKLNSVWVAL--NPPG 253 MSS +R +YVG L I++ ++E F KYG + + + + PPG Sbjct: 1 MSSRSSRTIYVGNLPGDIREREVEDLFSKYGPVVQIDLKIPPRPPG 46 >At4g02430.1 68417.m00329 pre-mRNA splicing factor, putative / SR1 protein, putative strong similarity to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana}; cDNA NCBI_gi:15810292 supports a truncated version while protein evidence supports a longer model. Length = 178 Score = 34.7 bits (76), Expect = 0.078 Identities = 14/38 (36%), Positives = 26/38 (68%) Frame = +1 Query: 241 KSPRFAFIEFENLQEAEDACSAMNGTEMLGATLKVEIS 354 + P +AF+EFE+ ++A+DA +G + G L+VE++ Sbjct: 43 RPPGYAFVEFEDARDADDAIYGRDGYDFDGHHLRVELA 80 Score = 29.9 bits (64), Expect = 2.2 Identities = 17/46 (36%), Positives = 27/46 (58%), Gaps = 3/46 (6%) Frame = +2 Query: 125 MSSGGTR-VYVGGLVEGIKKEDLEREFDKYGKLNSVWVAL--NPPG 253 MSS +R +YVG L I++ ++E F KYG + + + + PPG Sbjct: 1 MSSRSSRTIYVGNLPGDIREREVEDLFSKYGPVVQIDLKIPPRPPG 46 >At2g43410.1 68415.m05395 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 1056 Score = 33.9 bits (74), Expect = 0.14 Identities = 12/25 (48%), Positives = 19/25 (76%) Frame = +2 Query: 146 VYVGGLVEGIKKEDLEREFDKYGKL 220 ++VGG+ + K+DLE EF K+GK+ Sbjct: 252 LWVGGIGPNVSKDDLEEEFSKFGKI 276 >At5g58130.1 68418.m07273 RNA recognition motif (RRM)-containing protein Length = 748 Score = 33.5 bits (73), Expect = 0.18 Identities = 14/34 (41%), Positives = 23/34 (67%) Frame = +2 Query: 128 SSGGTRVYVGGLVEGIKKEDLEREFDKYGKLNSV 229 S GG R++VGGL E + ++DL + F G +++V Sbjct: 6 SGGGVRLHVGGLGESVGRDDLLKIFSPMGTVDAV 39 >At4g35785.2 68417.m05083 transformer serine/arginine-rich ribonucleoprotein, putative similar to transformer-SR ribonucleoprotein [Nicotiana tabacum] gi|1781299|emb|CAA70700 Length = 141 Score = 33.1 bits (72), Expect = 0.24 Identities = 15/37 (40%), Positives = 22/37 (59%) Frame = +2 Query: 137 GTRVYVGGLVEGIKKEDLEREFDKYGKLNSVWVALNP 247 GT +YV GL + +DLE F K GK+ S ++ + P Sbjct: 71 GTTLYVTGLSTRVTDKDLEAHFAKEGKVASCFLVMEP 107 >At4g35785.1 68417.m05082 transformer serine/arginine-rich ribonucleoprotein, putative similar to transformer-SR ribonucleoprotein [Nicotiana tabacum] gi|1781299|emb|CAA70700 Length = 140 Score = 33.1 bits (72), Expect = 0.24 Identities = 15/37 (40%), Positives = 22/37 (59%) Frame = +2 Query: 137 GTRVYVGGLVEGIKKEDLEREFDKYGKLNSVWVALNP 247 GT +YV GL + +DLE F K GK+ S ++ + P Sbjct: 70 GTTLYVTGLSTRVTDKDLEAHFAKEGKVASCFLVMEP 106 >At3g52380.1 68416.m05757 33 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp33, putative similar to chloroplast RNA-binding protein (cp33) GB:BAA06523 (Arabidopsis thaliana) (Plant Mol. Biol. 27 (3), 529-539 (1995)); contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 329 Score = 33.1 bits (72), Expect = 0.24 Identities = 13/38 (34%), Positives = 23/38 (60%) Frame = +1 Query: 241 KSPRFAFIEFENLQEAEDACSAMNGTEMLGATLKVEIS 354 +S F FI FE+ + + A + MNG E+ G L++ ++ Sbjct: 258 RSRGFGFISFESAENVQSALATMNGVEVEGRALRLNLA 295 >At5g04280.1 68418.m00421 glycine-rich RNA-binding protein Length = 310 Score = 32.7 bits (71), Expect = 0.32 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = +2 Query: 137 GTRVYVGGLVEGIKKEDLEREFDKYGKL 220 G+R++VGGL + DLER F ++G + Sbjct: 6 GSRIFVGGLSPEVTDRDLERAFSRFGDI 33 >At3g26420.1 68416.m03295 glycine-rich RNA-binding protein similar to RNA-binding protein (RZ-1) GB:BAA12064 [Nicotiana sylvestris]; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 245 Score = 32.7 bits (71), Expect = 0.32 Identities = 16/45 (35%), Positives = 26/45 (57%) Frame = +1 Query: 214 KTKLSLGSTKSPRFAFIEFENLQEAEDACSAMNGTEMLGATLKVE 348 K L S +S F FI F+ + ++A +AMNG ++ G T+ V+ Sbjct: 37 KVVLDKFSGRSRGFGFITFDEKKAMDEAIAAMNGMDLDGRTITVD 81 >At1g22760.1 68414.m02844 polyadenylate-binding protein 3 (PABP3) Length = 660 Score = 32.7 bits (71), Expect = 0.32 Identities = 15/41 (36%), Positives = 22/41 (53%) Frame = +2 Query: 131 SGGTRVYVGGLVEGIKKEDLEREFDKYGKLNSVWVALNPPG 253 S G +Y+ L + + E L+ F +YG + S V LNP G Sbjct: 329 SQGANLYLKNLDDSVDDEKLKEMFSEYGNVTSSKVMLNPQG 369 Score = 27.9 bits (59), Expect = 9.0 Identities = 13/39 (33%), Positives = 23/39 (58%) Frame = +2 Query: 140 TRVYVGGLVEGIKKEDLEREFDKYGKLNSVWVALNPPGS 256 T VYV L + I +++L + F K+G ++S V + G+ Sbjct: 229 TNVYVKNLPKEIGEDELRKTFGKFGVISSAVVMRDQSGN 267 >At1g07350.2 68414.m00784 transformer serine/arginine-rich ribonucleoprotein, putative similar to GB:Y09506 from [Nicotiana tabacum] (Plant Mol. Biol. 35 (3), 261-269 (1997)) Length = 129 Score = 32.7 bits (71), Expect = 0.32 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = +2 Query: 137 GTRVYVGGLVEGIKKEDLEREFDKYGKLNSVWVALNP 247 G +YV GL + + DLE F K GK+ V + L+P Sbjct: 44 GNSLYVTGLSHRVTERDLEDHFAKEGKVTDVHLVLDP 80 >At1g07350.1 68414.m00783 transformer serine/arginine-rich ribonucleoprotein, putative similar to GB:Y09506 from [Nicotiana tabacum] (Plant Mol. Biol. 35 (3), 261-269 (1997)) Length = 382 Score = 32.7 bits (71), Expect = 0.32 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = +2 Query: 137 GTRVYVGGLVEGIKKEDLEREFDKYGKLNSVWVALNP 247 G +YV GL + + DLE F K GK+ V + L+P Sbjct: 74 GNSLYVTGLSHRVTERDLEDHFAKEGKVTDVHLVLDP 110 >At2g42890.2 68415.m05312 RNA recognition motif (RRM)-containing protein Length = 830 Score = 32.3 bits (70), Expect = 0.42 Identities = 16/40 (40%), Positives = 28/40 (70%), Gaps = 1/40 (2%) Frame = +1 Query: 238 TKSPRF-AFIEFENLQEAEDACSAMNGTEMLGATLKVEIS 354 T + RF FIE+ ++++AE A A+N +E+ G +K+E+S Sbjct: 302 TPNRRFHRFIEYYDVRDAETALKALNRSEIGGKCIKLELS 341 >At2g42890.1 68415.m05311 RNA recognition motif (RRM)-containing protein Length = 843 Score = 32.3 bits (70), Expect = 0.42 Identities = 16/40 (40%), Positives = 28/40 (70%), Gaps = 1/40 (2%) Frame = +1 Query: 238 TKSPRF-AFIEFENLQEAEDACSAMNGTEMLGATLKVEIS 354 T + RF FIE+ ++++AE A A+N +E+ G +K+E+S Sbjct: 315 TPNRRFHRFIEYYDVRDAETALKALNRSEIGGKCIKLELS 354 >At2g35410.1 68415.m04340 33 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp33, putative similar to SP|P19684 33 kDa ribonucleoprotein, chloroplast precursor {Nicotiana sylvestris}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 308 Score = 32.3 bits (70), Expect = 0.42 Identities = 12/38 (31%), Positives = 24/38 (63%) Frame = +1 Query: 241 KSPRFAFIEFENLQEAEDACSAMNGTEMLGATLKVEIS 354 +S + F+ F +EAE+A + +NG E++G + ++ S Sbjct: 234 RSSGYGFVSFATREEAENAITKLNGKEIMGRPITLKFS 271 >At1g60650.2 68414.m06828 glycine-rich RNA-binding protein, putative similar to RNA binding protein(RZ-1) GI:1435061 from [Nicotiana sylvestris]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 292 Score = 32.3 bits (70), Expect = 0.42 Identities = 12/27 (44%), Positives = 19/27 (70%) Frame = +2 Query: 140 TRVYVGGLVEGIKKEDLEREFDKYGKL 220 +R++VGGL + + LE FD+YGK+ Sbjct: 12 SRIFVGGLSWDVTERQLESTFDRYGKI 38 >At1g60650.1 68414.m06827 glycine-rich RNA-binding protein, putative similar to RNA binding protein(RZ-1) GI:1435061 from [Nicotiana sylvestris]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 292 Score = 32.3 bits (70), Expect = 0.42 Identities = 12/27 (44%), Positives = 19/27 (70%) Frame = +2 Query: 140 TRVYVGGLVEGIKKEDLEREFDKYGKL 220 +R++VGGL + + LE FD+YGK+ Sbjct: 12 SRIFVGGLSWDVTERQLESTFDRYGKI 38 >At5g04600.1 68418.m00460 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 222 Score = 31.9 bits (69), Expect = 0.55 Identities = 16/37 (43%), Positives = 22/37 (59%) Frame = +1 Query: 241 KSPRFAFIEFENLQEAEDACSAMNGTEMLGATLKVEI 351 KS F FI+FE+ + AE A AMN ++ LKV + Sbjct: 99 KSKHFGFIQFEDPEVAEIAAGAMNDYLLMEHMLKVHV 135 >At3g47120.1 68416.m05116 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 352 Score = 31.9 bits (69), Expect = 0.55 Identities = 15/39 (38%), Positives = 24/39 (61%) Frame = +1 Query: 232 GSTKSPRFAFIEFENLQEAEDACSAMNGTEMLGATLKVE 348 G+ KS FAF+ +E+ + A +NG +LG T+KV+ Sbjct: 72 GTGKSKGFAFLAYEDQRSTILAVDNLNGALVLGRTIKVD 110 >At1g47490.1 68414.m05270 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein GI:1899187 from [Nicotiana tabacum] Length = 432 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/30 (40%), Positives = 22/30 (73%) Frame = +2 Query: 140 TRVYVGGLVEGIKKEDLEREFDKYGKLNSV 229 T ++VGGL + EDL++ F+++G++ SV Sbjct: 304 TTIFVGGLDSSVTDEDLKQPFNEFGEIVSV 333 >At1g20880.1 68414.m02615 RNA recognition motif (RRM)-containing protein similar to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); is the location of EST 197B1T7 , gb|AA597386 Length = 274 Score = 31.9 bits (69), Expect = 0.55 Identities = 13/27 (48%), Positives = 18/27 (66%) Frame = +2 Query: 140 TRVYVGGLVEGIKKEDLEREFDKYGKL 220 T+V+VGGL + E L R FD+YG + Sbjct: 24 TKVFVGGLAWETQSETLRRHFDQYGDI 50 >At4g34110.1 68417.m04839 polyadenylate-binding protein 2 (PABP2) non-consensus TA donor splice site at exon 2, polyadenylate-binding protein - Triticum aestivum (common wheat),PIR:T06979 Length = 443 Score = 31.5 bits (68), Expect = 0.73 Identities = 15/38 (39%), Positives = 20/38 (52%) Frame = +2 Query: 140 TRVYVGGLVEGIKKEDLEREFDKYGKLNSVWVALNPPG 253 T VYV L E +DL+ F +YGK+ S V + G Sbjct: 29 TNVYVKNLAESTTDDDLKNAFGEYGKITSAVVMKDGEG 66 Score = 29.1 bits (62), Expect = 3.9 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = +1 Query: 232 GSTKSPRFAFIEFENLQEAEDACSAMNG 315 G KS F F+ FEN +A A ++NG Sbjct: 64 GEGKSKGFGFVNFENADDAARAVESLNG 91 >At2g16940.1 68415.m01952 RNA recognition motif (RRM)-containing protein Length = 561 Score = 31.5 bits (68), Expect = 0.73 Identities = 14/42 (33%), Positives = 23/42 (54%) Frame = +2 Query: 128 SSGGTRVYVGGLVEGIKKEDLEREFDKYGKLNSVWVALNPPG 253 S G R+YVG L + ++DL + F+ +G + V V + G Sbjct: 281 SGGARRLYVGNLHINMSEDDLRKVFESFGSVELVQVPRDETG 322 Score = 29.1 bits (62), Expect = 3.9 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = +2 Query: 179 KEDLEREFDKYGKLNSVWVALNPPG 253 KED++ E K+GKLN ++V N G Sbjct: 488 KEDVKEECSKFGKLNHIFVDKNSVG 512 >At1g47500.1 68414.m05272 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein GI:1899187 from [Nicotiana tabacum] Length = 434 Score = 31.5 bits (68), Expect = 0.73 Identities = 12/30 (40%), Positives = 21/30 (70%) Frame = +2 Query: 140 TRVYVGGLVEGIKKEDLEREFDKYGKLNSV 229 T ++VGGL + EDL++ F ++G++ SV Sbjct: 306 TTIFVGGLDSSVTDEDLKQPFSEFGEIVSV 335 >At1g03457.2 68414.m00327 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 438 Score = 31.5 bits (68), Expect = 0.73 Identities = 12/33 (36%), Positives = 22/33 (66%) Frame = +1 Query: 253 FAFIEFENLQEAEDACSAMNGTEMLGATLKVEI 351 F FI +++ A++A + MNG ++ G LKV++ Sbjct: 382 FGFISYDSQAAAQNAINTMNGCQLSGKKLKVQL 414 >At1g03457.1 68414.m00326 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 429 Score = 31.5 bits (68), Expect = 0.73 Identities = 12/33 (36%), Positives = 22/33 (66%) Frame = +1 Query: 253 FAFIEFENLQEAEDACSAMNGTEMLGATLKVEI 351 F FI +++ A++A + MNG ++ G LKV++ Sbjct: 373 FGFISYDSQAAAQNAINTMNGCQLSGKKLKVQL 405 >At3g61860.1 68416.m06947 arginine/serine-rich splicing factor RSP31 (RSP31) identical to SP|P92964 Arginine/serine-rich splicing factor RSP31 {Arabidopsis thaliana} Length = 264 Score = 31.1 bits (67), Expect = 0.96 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = +2 Query: 146 VYVGGLVEGIKKEDLEREFDKYGKLNSV 229 V+VG ++ DLER FDKYG+++ V Sbjct: 4 VFVGNFEYETRQSDLERLFDKYGRVDRV 31 >At4g18120.1 68417.m02694 RNA recognition motif (RRM)-containing protein Mei2-like protein, Arabidopsis thaliana, gb:D86122 Length = 785 Score = 30.3 bits (65), Expect = 1.7 Identities = 13/32 (40%), Positives = 22/32 (68%) Frame = +1 Query: 259 FIEFENLQEAEDACSAMNGTEMLGATLKVEIS 354 F+EF +++ A+ A A+N TE+ G +K+E S Sbjct: 262 FVEFFDVRSADAALKALNRTEIAGKRIKLEHS 293 >At3g52150.1 68416.m05724 RNA recognition motif (RRM)-containing protein similar to chloroplast RNA-binding protein cp33 [Arabidopsis thaliana] GI:681912; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) domain Length = 253 Score = 30.3 bits (65), Expect = 1.7 Identities = 17/40 (42%), Positives = 23/40 (57%) Frame = +2 Query: 143 RVYVGGLVEGIKKEDLEREFDKYGKLNSVWVALNPPGSLS 262 +VYVG L + + KE LE F + GK+ S V+ P S S Sbjct: 178 KVYVGNLAKTVTKEMLENLFSEKGKVVSAKVSRVPGTSKS 217 Score = 28.7 bits (61), Expect = 5.1 Identities = 12/38 (31%), Positives = 23/38 (60%) Frame = +1 Query: 232 GSTKSPRFAFIEFENLQEAEDACSAMNGTEMLGATLKV 345 G++KS F F+ F + ++ E A A+N + + G ++V Sbjct: 213 GTSKSTGFGFVTFSSEEDVEAAIVALNNSLLEGQKIRV 250 Score = 27.9 bits (59), Expect = 9.0 Identities = 12/40 (30%), Positives = 22/40 (55%) Frame = +1 Query: 235 STKSPRFAFIEFENLQEAEDACSAMNGTEMLGATLKVEIS 354 S +S RF F +++++A +NG + G +KV I+ Sbjct: 113 SGRSRRFGFATMKSVEDANAVVEKLNGNTVEGREIKVNIT 152 >At2g44710.1 68415.m05564 RNA recognition motif (RRM)-containing protein Length = 809 Score = 30.3 bits (65), Expect = 1.7 Identities = 12/34 (35%), Positives = 21/34 (61%) Frame = +2 Query: 146 VYVGGLVEGIKKEDLEREFDKYGKLNSVWVALNP 247 ++VG L +G +EDL++ F G++ V + NP Sbjct: 216 IFVGSLDKGASEEDLKKVFGHVGEVTEVRILKNP 249 >At5g47330.1 68418.m05834 palmitoyl protein thioesterase family protein Length = 314 Score = 29.9 bits (64), Expect = 2.2 Identities = 15/30 (50%), Positives = 19/30 (63%) Frame = -2 Query: 326 NISVPFIALHASSASCKFSNSMKANLGDLV 237 ++SVPFI LH SA C SN+ AN L+ Sbjct: 24 SVSVPFIMLHGISAQC--SNARDANFTQLL 51 >At3g08000.1 68416.m00977 RNA-binding protein, putative similar to RNA-binding protein from [Nicotiana tabacum] GI:15822703, [Nicotiana sylvestris] GI:624925; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 143 Score = 29.9 bits (64), Expect = 2.2 Identities = 14/41 (34%), Positives = 23/41 (56%) Frame = +1 Query: 232 GSTKSPRFAFIEFENLQEAEDACSAMNGTEMLGATLKVEIS 354 GS +S F F++F +A A AM+G +LG L++ + Sbjct: 77 GSGRSRGFGFVDFAEEGDALSAKDAMDGKGLLGRPLRISFA 117 >At1g71770.1 68414.m08295 polyadenylate-binding protein 5 (PABP5) identical to GB:Q05196 from [Arabidopsis thaliana] Length = 668 Score = 29.9 bits (64), Expect = 2.2 Identities = 14/39 (35%), Positives = 23/39 (58%) Frame = +2 Query: 140 TRVYVGGLVEGIKKEDLEREFDKYGKLNSVWVALNPPGS 256 T VYV L + I ++L++ F KYG ++S V + G+ Sbjct: 225 TNVYVKNLPKEITDDELKKTFGKYGDISSAVVMKDQSGN 263 >At1g67550.1 68414.m07696 urease, putative / urea amidohydrolase, putative similar to SP|P07374 Urease (EC 3.5.1.5) (Urea amidohydrolase) {Canavalia ensiformis}; contains Pfam profile PF01979: Amidohydrolase family Length = 838 Score = 29.9 bits (64), Expect = 2.2 Identities = 17/48 (35%), Positives = 25/48 (52%), Gaps = 2/48 (4%) Frame = +2 Query: 362 GTGPAEVGSEVGAAVTSGVVV--HSEVREEAGSTTHTVAAAAGRTIVT 499 GT PA + + + A + V H++ E+G HT+ A GRTI T Sbjct: 494 GTTPAAIDNCLAVAEEYDIQVNIHTDTLNESGFVEHTINAFRGRTIHT 541 >At1g60000.1 68414.m06759 29 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp29, putative similar to 29 kDa ribonucleoprotein chloroplast precursor {Nicotiana sylvestris} SP|Q08935, SP|Q08937; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) contains an AG-donor site at intron. Length = 258 Score = 29.9 bits (64), Expect = 2.2 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = +1 Query: 241 KSPRFAFIEFENLQEAEDACSAMNGTEMLGATLKVEIS 354 +S FAF+ N+++ ++GTE LG LKV + Sbjct: 124 QSRGFAFVTMSNVEDCNIIIDNLDGTEYLGRALKVNFA 161 >At1g49760.1 68414.m05580 polyadenylate-binding protein, putative / PABP, putative similar to poly(A)-binding protein GB:AAF66825 GI:7673359 from [Nicotiana tabacum] Length = 671 Score = 29.9 bits (64), Expect = 2.2 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 232 GSTKSPRFAFIEFENLQEAEDACSAMNG 315 G KS F F+ FEN +A A A+NG Sbjct: 259 GEGKSKGFGFVNFENSDDAARAVDALNG 286 >At1g29400.2 68414.m03597 RNA recognition motif (RRM)-containing protein similar to GI:6650523 from [Arabidopsis thaliana] Length = 800 Score = 29.9 bits (64), Expect = 2.2 Identities = 14/32 (43%), Positives = 21/32 (65%) Frame = +1 Query: 259 FIEFENLQEAEDACSAMNGTEMLGATLKVEIS 354 F+EF +++ AE A A+N E+ G +KVE S Sbjct: 293 FVEFYDVRGAEAALKALNRCEIAGKRIKVEPS 324 >At1g29400.1 68414.m03596 RNA recognition motif (RRM)-containing protein similar to GI:6650523 from [Arabidopsis thaliana] Length = 800 Score = 29.9 bits (64), Expect = 2.2 Identities = 14/32 (43%), Positives = 21/32 (65%) Frame = +1 Query: 259 FIEFENLQEAEDACSAMNGTEMLGATLKVEIS 354 F+EF +++ AE A A+N E+ G +KVE S Sbjct: 293 FVEFYDVRGAEAALKALNRCEIAGKRIKVEPS 324 >At1g13690.1 68414.m01609 RNA recognition motif (RRM)-containing protein contains Pfam profile: PF00076 RNA recognition motif Length = 177 Score = 29.9 bits (64), Expect = 2.2 Identities = 15/44 (34%), Positives = 21/44 (47%) Frame = +1 Query: 214 KTKLSLGSTKSPRFAFIEFENLQEAEDACSAMNGTEMLGATLKV 345 KT L + K F F+ F ++A A M+G E+ G L V Sbjct: 43 KTPLDQANQKHRSFGFVTFLEREDASAAMDNMDGAELYGRVLTV 86 >At5g06210.1 68418.m00693 RNA-binding protein, putative contains similarity to RNA-binding protein from [Nicotiana tabacum] GI:15822703, [Nicotiana sylvestris] GI:624925, [Solanum tuberosum] GI:15822705; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 146 Score = 29.5 bits (63), Expect = 2.9 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = +1 Query: 235 STKSPRFAFIEFENLQEAEDACSAMNGTEMLGATLKVE 348 S +S F F+ F + EA+ A NG ++ G T+ V+ Sbjct: 71 SDRSKGFGFVTFASADEAQKALMEFNGQQLNGRTIFVD 108 >At4g32720.1 68417.m04657 RNA recognition motif (RRM)-containing protein RNA-binding protein LAH1, Saccharomyces cerevisiae, PIR2:B48600; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 433 Score = 29.5 bits (63), Expect = 2.9 Identities = 11/19 (57%), Positives = 16/19 (84%) Frame = +2 Query: 173 IKKEDLEREFDKYGKLNSV 229 +K+ED+E F +YGK+NSV Sbjct: 127 VKREDVESFFSQYGKVNSV 145 >At4g19610.1 68417.m02881 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 783 Score = 29.5 bits (63), Expect = 2.9 Identities = 15/38 (39%), Positives = 22/38 (57%) Frame = +1 Query: 241 KSPRFAFIEFENLQEAEDACSAMNGTEMLGATLKVEIS 354 KS +F FI F + QEA+ A N T + + + VEI+ Sbjct: 7 KSRQFGFIGFRSAQEAQQAIKYFNNTYLGTSLIIVEIA 44 >At4g13860.1 68417.m02147 glycine-rich RNA-binding protein, putative similar to Glycine-rich RNA-binding protein 2, mitochondrial precursor (AtGRP2) (Swiss-Prot:Q9SVM8) [Arabidopsis thaliana] ; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 87 Score = 29.5 bits (63), Expect = 2.9 Identities = 13/37 (35%), Positives = 22/37 (59%) Frame = +1 Query: 241 KSPRFAFIEFENLQEAEDACSAMNGTEMLGATLKVEI 351 +S F F+ + + EAE A S M+G E+ G + V++ Sbjct: 42 RSRGFGFVTYSSHSEAEAAVSGMDGKELNGRRVSVKL 78 >At2g23350.1 68415.m02788 polyadenylate-binding protein, putative / PABP, putative Length = 662 Score = 29.5 bits (63), Expect = 2.9 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = +1 Query: 232 GSTKSPRFAFIEFENLQEAEDACSAMNG 315 G KS F F+ FEN ++A A A+NG Sbjct: 260 GDGKSRCFGFVNFENPEDAARAVEALNG 287 >At1g76460.1 68414.m08893 RNA recognition motif (RRM)-containing protein low similarity to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 285 Score = 29.5 bits (63), Expect = 2.9 Identities = 11/27 (40%), Positives = 19/27 (70%) Frame = +2 Query: 140 TRVYVGGLVEGIKKEDLEREFDKYGKL 220 T+V+VGGL + E L + F++YG++ Sbjct: 24 TKVFVGGLAWETQSETLRQHFEQYGEI 50 >At5g55550.3 68418.m06922 RNA recognition motif (RRM)-containing protein similar to DAZ associated protein 1 [Homo sapiens] GI:8671754; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 460 Score = 29.1 bits (62), Expect = 3.9 Identities = 11/31 (35%), Positives = 20/31 (64%) Frame = +2 Query: 143 RVYVGGLVEGIKKEDLEREFDKYGKLNSVWV 235 +++VGGL I +E+ + FD++G + V V Sbjct: 111 KIFVGGLPSSITEEEFKNYFDQFGTIADVVV 141 >At5g55550.2 68418.m06921 RNA recognition motif (RRM)-containing protein similar to DAZ associated protein 1 [Homo sapiens] GI:8671754; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 460 Score = 29.1 bits (62), Expect = 3.9 Identities = 11/31 (35%), Positives = 20/31 (64%) Frame = +2 Query: 143 RVYVGGLVEGIKKEDLEREFDKYGKLNSVWV 235 +++VGGL I +E+ + FD++G + V V Sbjct: 111 KIFVGGLPSSITEEEFKNYFDQFGTIADVVV 141 >At5g55550.1 68418.m06920 RNA recognition motif (RRM)-containing protein similar to DAZ associated protein 1 [Homo sapiens] GI:8671754; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 448 Score = 29.1 bits (62), Expect = 3.9 Identities = 11/31 (35%), Positives = 20/31 (64%) Frame = +2 Query: 143 RVYVGGLVEGIKKEDLEREFDKYGKLNSVWV 235 +++VGGL I +E+ + FD++G + V V Sbjct: 111 KIFVGGLPSSITEEEFKNYFDQFGTIADVVV 141 >At5g46840.1 68418.m05771 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 501 Score = 29.1 bits (62), Expect = 3.9 Identities = 13/34 (38%), Positives = 22/34 (64%) Frame = +2 Query: 146 VYVGGLVEGIKKEDLEREFDKYGKLNSVWVALNP 247 V+VG L +KK+ + +EF K+G++ SV + P Sbjct: 173 VFVGNLPLKVKKKVILKEFSKFGEVESVRIRSVP 206 >At5g19960.1 68418.m02376 RNA recognition motif (RRM)-containing protein low similarity to glycine-rich RNA-binding protein [Euphorbia esula] GI:2645699; contains INTERPRO:IPR000504 RNA-binding region RNP-1 (RNA recognition motif) (RRM) domain Length = 337 Score = 29.1 bits (62), Expect = 3.9 Identities = 16/36 (44%), Positives = 21/36 (58%) Frame = +2 Query: 122 TMSSGGTRVYVGGLVEGIKKEDLEREFDKYGKLNSV 229 TM G + VYVGGL I +E + R F YG + +V Sbjct: 2 TMDDGNS-VYVGGLPYDITEEAVRRVFSIYGSVLTV 36 >At3g53500.1 68416.m05906 zinc knuckle (CCHC-type) family protein contains Pfam domain PF00098: Zinc knuckle Length = 243 Score = 29.1 bits (62), Expect = 3.9 Identities = 12/34 (35%), Positives = 23/34 (67%) Frame = +1 Query: 253 FAFIEFENLQEAEDACSAMNGTEMLGATLKVEIS 354 +AF+EF + ++A+DA ++G + G+ + VE S Sbjct: 5 YAFVEFSDPRDADDARYYLDGRDFDGSRITVEAS 38 >At2g37340.3 68415.m04580 splicing factor RSZ33 (RSZ33) nearly identical to splicing factor RSZ33 [Arabidopsis thaliana] GI:9843663; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF00098: Zinc knuckle Length = 249 Score = 29.1 bits (62), Expect = 3.9 Identities = 12/34 (35%), Positives = 23/34 (67%) Frame = +1 Query: 253 FAFIEFENLQEAEDACSAMNGTEMLGATLKVEIS 354 +AF+EF + ++A+DA ++G + G+ + VE S Sbjct: 5 YAFVEFGDPRDADDARHYLDGRDFDGSRITVEFS 38 >At1g49600.1 68414.m05561 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein ACBF GB:U90212 GI:1899187 from [Nicotiana tabacum] Length = 445 Score = 29.1 bits (62), Expect = 3.9 Identities = 12/33 (36%), Positives = 21/33 (63%) Frame = +2 Query: 131 SGGTRVYVGGLVEGIKKEDLEREFDKYGKLNSV 229 S + ++VGGL + +EDL + F +G++ SV Sbjct: 324 SNNSTIFVGGLDADVTEEDLMQPFSDFGEVVSV 356 >At1g34140.1 68414.m04235 polyadenylate-binding protein, putative / PABP, putative non-consensus splice donor TA at exon 1; similar to polyadenylate-binding protein (poly(A)-binding protein) from [Triticum aestivum] GI:1737492, [Nicotiana tabacum] GI:7673355, {Arabidopsis thaliana} SP|P42731; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 407 Score = 29.1 bits (62), Expect = 3.9 Identities = 15/38 (39%), Positives = 21/38 (55%) Frame = +2 Query: 140 TRVYVGGLVEGIKKEDLEREFDKYGKLNSVWVALNPPG 253 T VYV LVE DL+R F ++G++ S V + G Sbjct: 119 TNVYVKNLVETATDADLKRLFGEFGEITSAVVMKDGEG 156 Score = 29.1 bits (62), Expect = 3.9 Identities = 13/28 (46%), Positives = 15/28 (53%) Frame = +1 Query: 232 GSTKSPRFAFIEFENLQEAEDACSAMNG 315 G KS RF F+ FE + A A MNG Sbjct: 154 GEGKSRRFGFVNFEKAEAAVTAIEKMNG 181 >At5g59860.1 68418.m07506 RNA recognition motif (RRM)-containing protein similar to SP|Q14011 Cold-inducible RNA-binding protein (Glycine-rich RNA-binding protein CIRP) {Homo sapiens}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 157 Score = 28.7 bits (61), Expect = 5.1 Identities = 15/38 (39%), Positives = 23/38 (60%), Gaps = 1/38 (2%) Frame = +1 Query: 238 TKSPR-FAFIEFENLQEAEDACSAMNGTEMLGATLKVE 348 T+ P+ F FI FE+ +A+ A A+NG + G + VE Sbjct: 103 TQRPKGFGFITFESEDDAQKALKALNGKIVNGRLIFVE 140 >At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 105 Score = 28.7 bits (61), Expect = 5.1 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = +2 Query: 125 MSSGGTRVYVGGLVEGIKKEDLEREFDKYG 214 MS R +VGGL EDL+R F ++G Sbjct: 1 MSEVEYRCFVGGLAWATNDEDLQRTFSQFG 30 >At4g39260.3 68417.m05559 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 92 Score = 28.7 bits (61), Expect = 5.1 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = +2 Query: 125 MSSGGTRVYVGGLVEGIKKEDLEREFDKYG 214 MS R +VGGL EDL+R F ++G Sbjct: 1 MSEVEYRCFVGGLAWATNDEDLQRTFSQFG 30 Score = 27.9 bits (59), Expect = 9.0 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +1 Query: 235 STKSPRFAFIEFENLQEAEDACSAMNGTEMLGATLKV 345 S +S F F+ F++ + DA MNG E+ G + V Sbjct: 43 SGRSRGFGFVTFKDEKAMRDAIEEMNGKELDGRVITV 79 >At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 126 Score = 28.7 bits (61), Expect = 5.1 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = +2 Query: 125 MSSGGTRVYVGGLVEGIKKEDLEREFDKYG 214 MS R +VGGL EDL+R F ++G Sbjct: 1 MSEVEYRCFVGGLAWATNDEDLQRTFSQFG 30 Score = 27.9 bits (59), Expect = 9.0 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +1 Query: 235 STKSPRFAFIEFENLQEAEDACSAMNGTEMLGATLKV 345 S +S F F+ F++ + DA MNG E+ G + V Sbjct: 43 SGRSRGFGFVTFKDEKAMRDAIEEMNGKELDGRVITV 79 >At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 169 Score = 28.7 bits (61), Expect = 5.1 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = +2 Query: 125 MSSGGTRVYVGGLVEGIKKEDLEREFDKYG 214 MS R +VGGL EDL+R F ++G Sbjct: 1 MSEVEYRCFVGGLAWATNDEDLQRTFSQFG 30 Score = 27.9 bits (59), Expect = 9.0 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +1 Query: 235 STKSPRFAFIEFENLQEAEDACSAMNGTEMLGATLKV 345 S +S F F+ F++ + DA MNG E+ G + V Sbjct: 43 SGRSRGFGFVTFKDEKAMRDAIEEMNGKELDGRVITV 79 >At4g36690.3 68417.m05206 U2 snRNP auxiliary factor large subunit, putative similar to U2 snRNP auxiliary factor, large subunit [Nicotiana plumbaginifolia] GI:3850823 Length = 565 Score = 28.7 bits (61), Expect = 5.1 Identities = 13/34 (38%), Positives = 21/34 (61%) Frame = +1 Query: 244 SPRFAFIEFENLQEAEDACSAMNGTEMLGATLKV 345 S +AF +++L + AC+A+NG +M TL V Sbjct: 399 SKGYAFCVYQDLSVTDIACAALNGIKMGDKTLTV 432 >At4g36690.2 68417.m05207 U2 snRNP auxiliary factor large subunit, putative similar to U2 snRNP auxiliary factor, large subunit [Nicotiana plumbaginifolia] GI:3850823 Length = 542 Score = 28.7 bits (61), Expect = 5.1 Identities = 13/34 (38%), Positives = 21/34 (61%) Frame = +1 Query: 244 SPRFAFIEFENLQEAEDACSAMNGTEMLGATLKV 345 S +AF +++L + AC+A+NG +M TL V Sbjct: 399 SKGYAFCVYQDLSVTDIACAALNGIKMGDKTLTV 432 >At4g36690.1 68417.m05205 U2 snRNP auxiliary factor large subunit, putative similar to U2 snRNP auxiliary factor, large subunit [Nicotiana plumbaginifolia] GI:3850823 Length = 573 Score = 28.7 bits (61), Expect = 5.1 Identities = 13/34 (38%), Positives = 21/34 (61%) Frame = +1 Query: 244 SPRFAFIEFENLQEAEDACSAMNGTEMLGATLKV 345 S +AF +++L + AC+A+NG +M TL V Sbjct: 399 SKGYAFCVYQDLSVTDIACAALNGIKMGDKTLTV 432 >At4g03110.1 68417.m00420 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327, CUG-BP and ETR-3 like factor 3 [Homo sapiens] GI:12746392; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 441 Score = 28.7 bits (61), Expect = 5.1 Identities = 11/33 (33%), Positives = 20/33 (60%) Frame = +1 Query: 253 FAFIEFENLQEAEDACSAMNGTEMLGATLKVEI 351 F F+ +++ A++A MNG + G LKV++ Sbjct: 392 FGFVSYDSQAAAQNAIDMMNGRHLGGKKLKVQL 424 >At3g53460.2 68416.m05901 29 kDa ribonucleoprotein, chloroplast / RNA-binding protein cp 29 nearly identical to SP|Q43349 29 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein cp29) {Arabidopsis thaliana} Length = 334 Score = 28.3 bits (60), Expect = 6.8 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +2 Query: 128 SSGGTRVYVGGLVEGIKKEDLEREFDKYGKL 220 S G R+YVG L G+ LE F++ GK+ Sbjct: 245 SGSGNRLYVGNLSWGVDDMALENLFNEQGKV 275 Score = 28.3 bits (60), Expect = 6.8 Identities = 11/37 (29%), Positives = 22/37 (59%) Frame = +1 Query: 235 STKSPRFAFIEFENLQEAEDACSAMNGTEMLGATLKV 345 S +S F F+ + QE + A +++NG ++ G ++V Sbjct: 286 SGRSKGFGFVTLSSSQEVQKAINSLNGADLDGRQIRV 322 >At3g53460.1 68416.m05900 29 kDa ribonucleoprotein, chloroplast / RNA-binding protein cp 29 nearly identical to SP|Q43349 29 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein cp29) {Arabidopsis thaliana} Length = 342 Score = 28.3 bits (60), Expect = 6.8 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +2 Query: 128 SSGGTRVYVGGLVEGIKKEDLEREFDKYGKL 220 S G R+YVG L G+ LE F++ GK+ Sbjct: 253 SGSGNRLYVGNLSWGVDDMALENLFNEQGKV 283 Score = 28.3 bits (60), Expect = 6.8 Identities = 11/37 (29%), Positives = 22/37 (59%) Frame = +1 Query: 235 STKSPRFAFIEFENLQEAEDACSAMNGTEMLGATLKV 345 S +S F F+ + QE + A +++NG ++ G ++V Sbjct: 294 SGRSKGFGFVTLSSSQEVQKAINSLNGADLDGRQIRV 330 >At1g22330.1 68414.m02793 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 146 Score = 28.3 bits (60), Expect = 6.8 Identities = 10/27 (37%), Positives = 19/27 (70%) Frame = +2 Query: 140 TRVYVGGLVEGIKKEDLEREFDKYGKL 220 T+V+VGGL +++ R FD++G++ Sbjct: 17 TKVFVGGLAWETPTDEMRRYFDQFGEI 43 >At1g05510.1 68414.m00563 expressed protein Length = 241 Score = 28.3 bits (60), Expect = 6.8 Identities = 11/32 (34%), Positives = 20/32 (62%) Frame = +2 Query: 137 GTRVYVGGLVEGIKKEDLEREFDKYGKLNSVW 232 G +++ G+ E I+++DLE+ YGK+ W Sbjct: 121 GGFLFMPGVPEAIQRQDLEKVAKTYGKVYHFW 152 >At5g59950.3 68418.m07518 RNA and export factor-binding protein, putative Length = 242 Score = 27.9 bits (59), Expect = 9.0 Identities = 12/39 (30%), Positives = 21/39 (53%) Frame = +2 Query: 137 GTRVYVGGLVEGIKKEDLEREFDKYGKLNSVWVALNPPG 253 GT++Y+ L G+ ED++ F + G+L V + G Sbjct: 85 GTKLYISNLDYGVMNEDIKELFAEVGELKRYTVHFDRSG 123 >At5g59950.2 68418.m07519 RNA and export factor-binding protein, putative Length = 178 Score = 27.9 bits (59), Expect = 9.0 Identities = 12/39 (30%), Positives = 21/39 (53%) Frame = +2 Query: 137 GTRVYVGGLVEGIKKEDLEREFDKYGKLNSVWVALNPPG 253 GT++Y+ L G+ ED++ F + G+L V + G Sbjct: 21 GTKLYISNLDYGVMNEDIKELFAEVGELKRYTVHFDRSG 59 >At5g59950.1 68418.m07517 RNA and export factor-binding protein, putative Length = 244 Score = 27.9 bits (59), Expect = 9.0 Identities = 12/39 (30%), Positives = 21/39 (53%) Frame = +2 Query: 137 GTRVYVGGLVEGIKKEDLEREFDKYGKLNSVWVALNPPG 253 GT++Y+ L G+ ED++ F + G+L V + G Sbjct: 87 GTKLYISNLDYGVMNEDIKELFAEVGELKRYTVHFDRSG 125 >At5g09880.1 68418.m01142 RNA recognition motif (RRM)-containing protein Length = 527 Score = 27.9 bits (59), Expect = 9.0 Identities = 14/32 (43%), Positives = 21/32 (65%), Gaps = 1/32 (3%) Frame = +1 Query: 253 FAFIEFENLQEAEDACSAMNG-TEMLGATLKV 345 F FI+F L+ ++ A A+NG E+ G T+KV Sbjct: 308 FGFIQFVQLEHSKAAQIALNGKLEIAGRTIKV 339 >At5g07060.1 68418.m00799 zinc finger (CCCH-type) family protein contains Pfam domain, PF00642: Zinc finger C-x8-C-x5-C-x3-H type (and similar) Length = 363 Score = 27.9 bits (59), Expect = 9.0 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = +2 Query: 146 VYVGGLVEGIKKEDLEREFDKYGKLNSVWV 235 +YVGGL I ++D+ F YG++ S+ V Sbjct: 227 LYVGGLNSRIFEQDIHDHFYAYGEMESIRV 256 >At3g14100.1 68416.m01782 oligouridylate-binding protein, putative similar to GB:CAB75429 (GI:6996560) from [Nicotiana plumbaginifolia], contains Pfam profiles: PF00076 RNA recognition motif (3 copies) Length = 427 Score = 27.9 bits (59), Expect = 9.0 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +1 Query: 241 KSPRFAFIEFENLQEAEDACSAMNG 315 +S F F+ F N Q+A+ A + MNG Sbjct: 183 RSRGFGFVSFRNQQDAQTAINEMNG 207 >At1g54080.2 68414.m06163 oligouridylate-binding protein, putative similar to oligouridylate binding protein GI:6996560 from [Nicotiana plumbaginifolia] Length = 430 Score = 27.9 bits (59), Expect = 9.0 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +1 Query: 241 KSPRFAFIEFENLQEAEDACSAMNG 315 +S F F+ F N Q+A+ A + MNG Sbjct: 191 RSRGFGFVSFRNQQDAQTAINEMNG 215 >At1g54080.1 68414.m06162 oligouridylate-binding protein, putative similar to oligouridylate binding protein GI:6996560 from [Nicotiana plumbaginifolia] Length = 426 Score = 27.9 bits (59), Expect = 9.0 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +1 Query: 241 KSPRFAFIEFENLQEAEDACSAMNG 315 +S F F+ F N Q+A+ A + MNG Sbjct: 187 RSRGFGFVSFRNQQDAQTAINEMNG 211 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,602,612 Number of Sequences: 28952 Number of extensions: 229946 Number of successful extensions: 882 Number of sequences better than 10.0: 88 Number of HSP's better than 10.0 without gapping: 761 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 882 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1960634400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -