BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0954 (843 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_33239| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_4649| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_53276| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_34659| Best HMM Match : WD40 (HMM E-Value=1.1e-34) 36 0.031 SB_14705| Best HMM Match : WD40 (HMM E-Value=3.6e-20) 34 0.17 SB_36049| Best HMM Match : WD40 (HMM E-Value=2e-07) 33 0.22 SB_33678| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.38 SB_57808| Best HMM Match : WD40 (HMM E-Value=2.5e-22) 32 0.67 SB_8844| Best HMM Match : WD40 (HMM E-Value=2.5e-28) 32 0.67 SB_3361| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.67 SB_47704| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.89 SB_49401| Best HMM Match : WD40 (HMM E-Value=1.6e-22) 31 1.5 SB_44544| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_41443| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_30239| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_3382| Best HMM Match : WD40 (HMM E-Value=2.8e-05) 30 2.0 SB_54574| Best HMM Match : WD40 (HMM E-Value=0) 30 2.0 SB_5480| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_47598| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_53453| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_23364| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_12443| Best HMM Match : WD40 (HMM E-Value=1e-24) 29 3.6 SB_18329| Best HMM Match : AMP-binding (HMM E-Value=2.7e-18) 29 4.7 SB_17098| Best HMM Match : WD40 (HMM E-Value=8.9e-32) 29 4.7 SB_14111| Best HMM Match : WD40 (HMM E-Value=6.2e-30) 29 4.7 SB_7939| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.2 SB_52616| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.2 SB_43298| Best HMM Match : WD40 (HMM E-Value=1.7e-30) 29 6.2 SB_30771| Best HMM Match : WD40 (HMM E-Value=2e-06) 29 6.2 SB_45648| Best HMM Match : WD40 (HMM E-Value=2.4e-14) 28 8.2 SB_44731| Best HMM Match : WD40 (HMM E-Value=1.1e-11) 28 8.2 SB_43403| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.2 SB_26375| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.2 >SB_33239| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 96 Score = 65.3 bits (152), Expect = 6e-11 Identities = 28/51 (54%), Positives = 34/51 (66%), Gaps = 2/51 (3%) Frame = +2 Query: 353 DPDDDSEKTGKI--LEDGVLQSYEQHEDSVYCSEWSTVEPWTFASLSYDAR 499 D D+D G DGV+ SY++HEDSVY EWST +PW FASLSYD + Sbjct: 16 DEDEDQRDKGSSGPASDGVIASYDEHEDSVYAVEWSTADPWVFASLSYDVQ 66 >SB_4649| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 475 Score = 43.2 bits (97), Expect = 3e-04 Identities = 25/73 (34%), Positives = 39/73 (53%), Gaps = 1/73 (1%) Frame = +3 Query: 30 AVLQDMHIKCFDTR-TDCSKPSWSIDNAHRQLVRDLDFNPNRQFHLASAGDDAALNIWDY 206 +V D + +DTR T+ +K + ++D AH V L FNP +F LA+ D + +WD Sbjct: 293 SVADDHKLMIWDTRQTNSNKAAHTVD-AHTAEVNCLSFNPYSEFILATGSADKTVALWDL 351 Query: 207 RNGKEPIFNRTDH 245 RN K + + H Sbjct: 352 RNLKLKLHSFESH 364 Score = 29.9 bits (64), Expect = 2.7 Identities = 17/51 (33%), Positives = 25/51 (49%) Frame = +3 Query: 63 DTRTDCSKPSWSIDNAHRQLVRDLDFNPNRQFHLASAGDDAALNIWDYRNG 215 D +CS P + H + L +NPN +L SA DD + +WD +G Sbjct: 228 DPNGECS-PDLRL-KGHTKEGYGLSWNPNVNGNLLSASDDHTICLWDISSG 276 Score = 29.5 bits (63), Expect = 3.6 Identities = 10/32 (31%), Positives = 21/32 (65%) Frame = +3 Query: 108 AHRQLVRDLDFNPNRQFHLASAGDDAALNIWD 203 +H+ + + ++P+ + LAS+G D L++WD Sbjct: 363 SHKDEIFQVQWSPHNETILASSGTDRRLHVWD 394 Score = 28.7 bits (61), Expect = 6.2 Identities = 10/34 (29%), Positives = 16/34 (47%) Frame = +3 Query: 99 IDNAHRQLVRDLDFNPNRQFHLASAGDDAALNIW 200 I H + D +NPN + L S +D + +W Sbjct: 417 IHGGHTAKISDFSWNPNEPWVLCSVSEDNIMQVW 450 >SB_53276| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 424 Score = 36.3 bits (80), Expect = 0.031 Identities = 21/67 (31%), Positives = 35/67 (52%), Gaps = 1/67 (1%) Frame = +3 Query: 51 IKCFDTRTDCSKPSWS-IDNAHRQLVRDLDFNPNRQFHLASAGDDAALNIWDYRNGKEPI 227 +K +D R +KPS + + + R + +D +P + LA+ G D L+IWD R + P+ Sbjct: 175 VKMWDLRNRNNKPSRTMLLSGDRVPLLCVDKHPTQPHLLAAGGQDGVLSIWDMRQEQYPV 234 Query: 228 FNRTDHS 248 HS Sbjct: 235 TLLEGHS 241 >SB_34659| Best HMM Match : WD40 (HMM E-Value=1.1e-34) Length = 292 Score = 36.3 bits (80), Expect = 0.031 Identities = 19/46 (41%), Positives = 29/46 (63%) Frame = +3 Query: 111 HRQLVRDLDFNPNRQFHLASAGDDAALNIWDYRNGKEPIFNRTDHS 248 HRQ V L ++P+ Q HLAS G+D L +W+ +G PI ++H+ Sbjct: 145 HRQEVCGLKWSPDHQ-HLASGGNDNKLLVWNL-SGSTPIQQYSEHT 188 >SB_14705| Best HMM Match : WD40 (HMM E-Value=3.6e-20) Length = 215 Score = 33.9 bits (74), Expect = 0.17 Identities = 17/49 (34%), Positives = 24/49 (48%) Frame = +3 Query: 108 AHRQLVRDLDFNPNRQFHLASAGDDAALNIWDYRNGKEPIFNRTDHSHW 254 AH V + F +R F S DD + +WD RN K +F+ H+ W Sbjct: 110 AHSDCVNCVRFLDSRSFLTCS--DDKTICLWDARNLKSNVFSLVGHTSW 156 >SB_36049| Best HMM Match : WD40 (HMM E-Value=2e-07) Length = 711 Score = 33.5 bits (73), Expect = 0.22 Identities = 20/64 (31%), Positives = 33/64 (51%), Gaps = 1/64 (1%) Frame = +3 Query: 60 FDTRTDCSKPSWS-IDNAHRQLVRDLDFNPNRQFHLASAGDDAALNIWDYRNGKEPIFNR 236 +D R +KPS + + + R + +D +P + LA+ G D L+IWD R + P+ Sbjct: 2 WDLRNRNNKPSRTMLLSGDRVPLLCVDKHPTQPHLLAAGGQDGVLSIWDMRQEQYPVTLL 61 Query: 237 TDHS 248 HS Sbjct: 62 EGHS 65 >SB_33678| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1308 Score = 32.7 bits (71), Expect = 0.38 Identities = 16/39 (41%), Positives = 21/39 (53%) Frame = +3 Query: 105 NAHRQLVRDLDFNPNRQFHLASAGDDAALNIWDYRNGKE 221 N H V+ LDFNP + LAS D+ + IWD + E Sbjct: 120 NKHSGAVQALDFNPFQPNLLASGASDSEIFIWDMNSPGE 158 >SB_57808| Best HMM Match : WD40 (HMM E-Value=2.5e-22) Length = 195 Score = 31.9 bits (69), Expect = 0.67 Identities = 14/33 (42%), Positives = 20/33 (60%) Frame = +3 Query: 108 AHRQLVRDLDFNPNRQFHLASAGDDAALNIWDY 206 AH++ VR L F+P + AS DD + IWD+ Sbjct: 111 AHKEPVRGLSFSPTDNKY-ASCADDGLVKIWDF 142 >SB_8844| Best HMM Match : WD40 (HMM E-Value=2.5e-28) Length = 539 Score = 31.9 bits (69), Expect = 0.67 Identities = 19/66 (28%), Positives = 32/66 (48%), Gaps = 2/66 (3%) Frame = +3 Query: 27 FAVLQDM--HIKCFDTRTDCSKPSWSIDNAHRQLVRDLDFNPNRQFHLASAGDDAALNIW 200 FA++ D H+ F+ ++ + S+ AH+ VR + + Q L SAG D+ L W Sbjct: 339 FAIIGDSKGHVDSFNIQSGNHRASYGNPRAHKGCVRGVAIDGVNQ-QLLSAGADSQLRFW 397 Query: 201 DYRNGK 218 + K Sbjct: 398 SFTKRK 403 >SB_3361| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 247 Score = 31.9 bits (69), Expect = 0.67 Identities = 16/53 (30%), Positives = 28/53 (52%) Frame = +3 Query: 96 SIDNAHRQLVRDLDFNPNRQFHLASAGDDAALNIWDYRNGKEPIFNRTDHSHW 254 ++ AH VR +DF+ + Q L +A DD +L +W K +++ H +W Sbjct: 22 TVFKAHTATVRSVDFSGDGQ-SLLTASDDKSLKVWTVHRQKF-LYSLNAHMNW 72 >SB_47704| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 296 Score = 31.5 bits (68), Expect = 0.89 Identities = 14/34 (41%), Positives = 20/34 (58%) Frame = +3 Query: 117 QLVRDLDFNPNRQFHLASAGDDAALNIWDYRNGK 218 Q +R L F+ ++ LAS DD A N+WD + K Sbjct: 126 QAIRGLQFSHFKKALLASVSDDGASNLWDTNSRK 159 >SB_49401| Best HMM Match : WD40 (HMM E-Value=1.6e-22) Length = 453 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/36 (36%), Positives = 21/36 (58%) Frame = +3 Query: 111 HRQLVRDLDFNPNRQFHLASAGDDAALNIWDYRNGK 218 HR+ + + +NP+ + LASAG D + IW + K Sbjct: 60 HRKTITAIAWNPHNEDILASAGADCRVLIWSIKEQK 95 >SB_44544| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1480 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/42 (30%), Positives = 22/42 (52%) Frame = +3 Query: 108 AHRQLVRDLDFNPNRQFHLASAGDDAALNIWDYRNGKEPIFN 233 AH V LD++P + +A+ G D + +WD + P+ N Sbjct: 419 AHNGPVFTLDWHPEDRNWIATGGRDKCVKVWDVQGKATPVNN 460 >SB_41443| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 482 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/31 (48%), Positives = 21/31 (67%) Frame = +3 Query: 111 HRQLVRDLDFNPNRQFHLASAGDDAALNIWD 203 H Q V L ++P+ ++ LAS G+D LNIWD Sbjct: 290 HTQEVCGLKWSPDGKY-LASGGNDNLLNIWD 319 >SB_30239| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 525 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = +3 Query: 105 NAHRQLVRDLDFNPNRQFHLASAGDDAALNIW 200 N H + V DL +NP +ASA +D ++ IW Sbjct: 83 NGHTRPVLDLGWNPFDDNVIASASEDCSIKIW 114 >SB_3382| Best HMM Match : WD40 (HMM E-Value=2.8e-05) Length = 375 Score = 30.3 bits (65), Expect = 2.0 Identities = 19/69 (27%), Positives = 29/69 (42%) Frame = +3 Query: 51 IKCFDTRTDCSKPSWSIDNAHRQLVRDLDFNPNRQFHLASAGDDAALNIWDYRNGKEPIF 230 + C D RTD P ++I NAH + L + L +A D + +WD ++ K Sbjct: 218 VYCCDVRTDA--PVFTI-NAHDSAIAGLVLSSQVPNCLVTASADGNMKVWDIKDNKPSFI 274 Query: 231 NRTDHSHWC 257 D C Sbjct: 275 LTRDMQMKC 283 >SB_54574| Best HMM Match : WD40 (HMM E-Value=0) Length = 1050 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +3 Query: 111 HRQLVRDLDFNPNRQFHLASAGDDAALNIWDYRNGKE 221 H +VR + F+P+ + + DD + IWD +GKE Sbjct: 968 HPDVVRSISFSPDNM--ICTGCDDGIVRIWDSVSGKE 1002 Score = 29.5 bits (63), Expect = 3.6 Identities = 17/60 (28%), Positives = 32/60 (53%) Frame = +3 Query: 42 DMHIKCFDTRTDCSKPSWSIDNAHRQLVRDLDFNPNRQFHLASAGDDAALNIWDYRNGKE 221 D +K +D++T + + AH +VR F+P+ +AS DD + IW+ +G++ Sbjct: 615 DRTVKVWDSKTGVC---YHVYMAHTDIVRWCCFSPDGG-KVASCSDDNTVRIWEASSGED 670 >SB_5480| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 335 Score = 30.3 bits (65), Expect = 2.0 Identities = 11/41 (26%), Positives = 21/41 (51%) Frame = +3 Query: 96 SIDNAHRQLVRDLDFNPNRQFHLASAGDDAALNIWDYRNGK 218 ++ H + + F P+R + L S G D + WD+ +G+ Sbjct: 132 TLSRVHTNICSTVQFRPHRPWGLVSGGMDYRVAHWDFSSGR 172 >SB_47598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2332 Score = 29.9 bits (64), Expect = 2.7 Identities = 26/80 (32%), Positives = 33/80 (41%), Gaps = 4/80 (5%) Frame = +2 Query: 305 SSDGRGLLYAAASICR----DPDDDSEKTGKILEDGVLQSYEQHEDSVYCSEWSTVEPWT 472 SSD G +YA A D DDD + +L DGV+ ++ D Y S P Sbjct: 1773 SSDADGDIYATAFSPNNDDGDNDDDDDNGSYVLSDGVIDTFT--SDETYDERMS---PKQ 1827 Query: 473 FASLSYDARLVIRESLDRSN 532 A S + I E LD N Sbjct: 1828 HALSSPSPSITISEELDIKN 1847 >SB_53453| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 192 Score = 29.5 bits (63), Expect = 3.6 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = -1 Query: 210 SYSPICSALRHHPRWPGGTGDS 145 S SP+C+ LR HP G GDS Sbjct: 56 SLSPLCALLRDHPGTRSGIGDS 77 >SB_23364| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 29.5 bits (63), Expect = 3.6 Identities = 10/25 (40%), Positives = 17/25 (68%) Frame = -2 Query: 278 SCCILPSTPVRVIGSVEYRLFPVPI 204 SCC++P PV VI ++ +FP+ + Sbjct: 21 SCCVIPFAPVTVICTLRLIVFPISL 45 >SB_12443| Best HMM Match : WD40 (HMM E-Value=1e-24) Length = 515 Score = 29.5 bits (63), Expect = 3.6 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +3 Query: 111 HRQLVRDLDFNPNRQFHLASAGDDAALNIWDYR 209 H+ +V + FNP L SA DD L +W R Sbjct: 476 HQNVVNCVAFNPRDPDMLVSASDDHTLRVWKSR 508 >SB_18329| Best HMM Match : AMP-binding (HMM E-Value=2.7e-18) Length = 1076 Score = 29.1 bits (62), Expect = 4.7 Identities = 14/46 (30%), Positives = 24/46 (52%) Frame = -2 Query: 302 QSTVTVRGSCCILPSTPVRVIGSVEYRLFPVPIVPYVQRCVITRAG 165 Q+ V+ S C+ P+T + +GS ++ L+ + I V C I G Sbjct: 859 QTHAPVKSSPCVDPTTGLVWVGSHDHHLYALDITNRVSACAIDCGG 904 >SB_17098| Best HMM Match : WD40 (HMM E-Value=8.9e-32) Length = 808 Score = 29.1 bits (62), Expect = 4.7 Identities = 18/49 (36%), Positives = 25/49 (51%), Gaps = 2/49 (4%) Frame = +3 Query: 108 AHRQLVRDLDFNPNRQFH--LASAGDDAALNIWDYRNGKEPIFNRTDHS 248 AH V ++F+P + H LASAG D ++I+D I DHS Sbjct: 394 AHESEVLCVEFSPPQSGHKLLASAGRDRLIHIFDMNKDFSLIQTLDDHS 442 >SB_14111| Best HMM Match : WD40 (HMM E-Value=6.2e-30) Length = 1093 Score = 29.1 bits (62), Expect = 4.7 Identities = 16/37 (43%), Positives = 20/37 (54%), Gaps = 1/37 (2%) Frame = +3 Query: 108 AHRQLVRDLDFNPNRQFHLASAGDDAALNIWD-YRNG 215 AH V LD+NP LAS D ++ +WD Y NG Sbjct: 202 AHTSGVNRLDWNPVYTNLLASCSMDNSVRVWDTYLNG 238 >SB_7939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 289 Score = 28.7 bits (61), Expect = 6.2 Identities = 17/47 (36%), Positives = 25/47 (53%) Frame = +3 Query: 3 NPHQGHTQFAVLQDMHIKCFDTRTDCSKPSWSIDNAHRQLVRDLDFN 143 +PHQG+ + D IK +DT T P +I++ H + LDFN Sbjct: 150 SPHQGNIIASCSYDFTIKTWDT-TSTLAPLETIEH-HSEFATGLDFN 194 >SB_52616| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1855 Score = 28.7 bits (61), Expect = 6.2 Identities = 10/34 (29%), Positives = 16/34 (47%) Frame = +3 Query: 99 IDNAHRQLVRDLDFNPNRQFHLASAGDDAALNIW 200 I H + D +NPN + L S +D + +W Sbjct: 897 IHGGHTAKISDFSWNPNEPWVLCSVSEDNIMQVW 930 >SB_43298| Best HMM Match : WD40 (HMM E-Value=1.7e-30) Length = 685 Score = 28.7 bits (61), Expect = 6.2 Identities = 14/32 (43%), Positives = 20/32 (62%) Frame = +3 Query: 111 HRQLVRDLDFNPNRQFHLASAGDDAALNIWDY 206 H Q V L ++P+ + LAS G+D +NIW Y Sbjct: 470 HSQEVCGLKWSPDGKL-LASGGNDNVVNIWPY 500 >SB_30771| Best HMM Match : WD40 (HMM E-Value=2e-06) Length = 229 Score = 28.7 bits (61), Expect = 6.2 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = +3 Query: 105 NAHRQLVRDLDFNPNRQFHLASAGDDAALNIWDYRNGKE 221 N +RDL FN N+ HLA+ A ++IWD + K+ Sbjct: 71 NLSTNRIRDLAFN-NKTGHLAALSPLAFIHIWDMISEKQ 108 >SB_45648| Best HMM Match : WD40 (HMM E-Value=2.4e-14) Length = 316 Score = 28.3 bits (60), Expect = 8.2 Identities = 10/30 (33%), Positives = 18/30 (60%) Frame = +3 Query: 138 FNPNRQFHLASAGDDAALNIWDYRNGKEPI 227 FNP ++HL+ D ++ +D R+ +PI Sbjct: 110 FNPESRYHLSFGSADHCVHYYDLRHAAKPI 139 >SB_44731| Best HMM Match : WD40 (HMM E-Value=1.1e-11) Length = 256 Score = 28.3 bits (60), Expect = 8.2 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = +3 Query: 111 HRQLVRDLDFNPNRQFHLASAGDDAALNIWDY 206 H + + F+P+ LAS G D A+ +WD+ Sbjct: 180 HTDTIHTMSFSPDGTL-LASGGMDGAVRVWDF 210 >SB_43403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 539 Score = 28.3 bits (60), Expect = 8.2 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = +3 Query: 138 FNPNRQFHLASAGDDAALNIWDYRNGK 218 F+PN ++ LA+ D+ L +WDY GK Sbjct: 130 FSPNGKYILAATLDNT-LKLWDYSKGK 155 >SB_26375| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 297 Score = 28.3 bits (60), Expect = 8.2 Identities = 18/64 (28%), Positives = 34/64 (53%) Frame = +3 Query: 48 HIKCFDTRTDCSKPSWSIDNAHRQLVRDLDFNPNRQFHLASAGDDAALNIWDYRNGKEPI 227 HI+ +D + P S D + V + F+ + ++ + + G+D++ IWD R K+ Sbjct: 61 HIRLYDINSANPNPVVSYDGVSKN-VTAVGFHEDGKW-MFTGGEDSSARIWDLR--KQID 116 Query: 228 FNRT 239 F+RT Sbjct: 117 FSRT 120 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,504,494 Number of Sequences: 59808 Number of extensions: 453604 Number of successful extensions: 1346 Number of sequences better than 10.0: 33 Number of HSP's better than 10.0 without gapping: 1241 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1345 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2383424791 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -