BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0953 (844 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY347952-1|AAR28375.1| 634|Anopheles gambiae putative sulfakini... 25 2.2 AJ302660-1|CAC35525.1| 195|Anopheles gambiae hypothetical prote... 25 3.8 >AY347952-1|AAR28375.1| 634|Anopheles gambiae putative sulfakinin GPCR protein. Length = 634 Score = 25.4 bits (53), Expect = 2.2 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = -1 Query: 82 FKSYRTKMPVPNIFCCTQNS 23 F YR +MP+ FCC ++ Sbjct: 538 FSCYRNRMPICCCFCCASSN 557 >AJ302660-1|CAC35525.1| 195|Anopheles gambiae hypothetical protein protein. Length = 195 Score = 24.6 bits (51), Expect = 3.8 Identities = 18/53 (33%), Positives = 25/53 (47%) Frame = +2 Query: 215 PLFIVVSLLASIEATVVLNRLPRAHRPGVPVSPQNQTMTTTASTAAECGISGA 373 PL LL + A + LP + P + SP T+ TT+ TAA G S + Sbjct: 10 PLLSAAVLLQPLLAAPIFWFLPWSF-PAL--SPTTTTLATTSGTAASSGASNS 59 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 925,379 Number of Sequences: 2352 Number of extensions: 20746 Number of successful extensions: 69 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 68 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 69 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 89305416 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -