BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0949 (837 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 22 5.2 AJ850297-1|CAH64517.1| 539|Tribolium castaneum putative esteras... 22 6.9 AJ850295-1|CAH64515.1| 539|Tribolium castaneum putative esteras... 22 6.9 EU019709-1|ABU25221.1| 540|Tribolium castaneum aspartate 1-deca... 21 9.1 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 22.2 bits (45), Expect = 5.2 Identities = 9/31 (29%), Positives = 19/31 (61%) Frame = +1 Query: 541 CSRRPRTTQSSASS*IQDGAVSHFPFGWLLS 633 C++ P + +S+ + +++ + P GWLLS Sbjct: 1954 CNKGPASDKSAFADFVKELHEAFKPKGWLLS 1984 >AJ850297-1|CAH64517.1| 539|Tribolium castaneum putative esterase protein. Length = 539 Score = 21.8 bits (44), Expect = 6.9 Identities = 13/50 (26%), Positives = 21/50 (42%) Frame = +1 Query: 334 GSSIQCCRALPLYQRIVP*PVS*TVWVIAVSNAPPVNRLLRHQPQVATRP 483 G+ I+C ++ P Q + P W + + PV QP + T P Sbjct: 252 GTMIKCLKSRPARQIALTVPRYQAWWYLPFAQFGPVIDSWATQPVLPTHP 301 >AJ850295-1|CAH64515.1| 539|Tribolium castaneum putative esterase protein. Length = 539 Score = 21.8 bits (44), Expect = 6.9 Identities = 13/50 (26%), Positives = 21/50 (42%) Frame = +1 Query: 334 GSSIQCCRALPLYQRIVP*PVS*TVWVIAVSNAPPVNRLLRHQPQVATRP 483 G+ I+C ++ P Q + P W + + PV QP + T P Sbjct: 252 GTMIKCLKSRPARQIALTVPRYQAWWYLPFAQFGPVIDSWATQPVLPTHP 301 >EU019709-1|ABU25221.1| 540|Tribolium castaneum aspartate 1-decarboxylase protein. Length = 540 Score = 21.4 bits (43), Expect = 9.1 Identities = 11/41 (26%), Positives = 16/41 (39%) Frame = +2 Query: 710 IGHRSHRGGSMGVVYERRSRSPTFAXFSIEXLNFPTCDVGH 832 I R + GSM V Y+ + P F + D+ H Sbjct: 488 IKERMMKEGSMMVTYQAQKGHPNFFRIVFQNSGLDKADMVH 528 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 191,509 Number of Sequences: 336 Number of extensions: 4121 Number of successful extensions: 8 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 23036718 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -