BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0946 (823 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cycl... 25 1.1 AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase prot... 23 4.5 DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase ... 22 7.9 DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase ... 22 7.9 >AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cyclase alpha 1 subunit protein. Length = 699 Score = 24.6 bits (51), Expect = 1.1 Identities = 15/41 (36%), Positives = 25/41 (60%) Frame = +1 Query: 187 KGHGGQWLPISHLRVIETSEDVGVESDIGSQSVSSDGLRRR 309 +G G+ L IS + + + + DV + +G Q+ + DGLRRR Sbjct: 401 EGLTGRGLFISDIPLHDATRDVIL---VGEQARAQDGLRRR 438 >AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase protein. Length = 693 Score = 22.6 bits (46), Expect = 4.5 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = +1 Query: 61 KLVVCRSDFYRTKTTQSEVIGCK 129 +L V SD+ + Q+E IGCK Sbjct: 600 ELFVMVSDYKDDRVEQNEPIGCK 622 >DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase isoform B protein. Length = 931 Score = 21.8 bits (44), Expect = 7.9 Identities = 9/23 (39%), Positives = 11/23 (47%) Frame = -3 Query: 554 PRRLPYFANEFLGLFAALWASAP 486 P RLP F +E L W+ P Sbjct: 821 PERLPSFDDECWRLMEQCWSGEP 843 >DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase isoform A protein. Length = 969 Score = 21.8 bits (44), Expect = 7.9 Identities = 9/23 (39%), Positives = 11/23 (47%) Frame = -3 Query: 554 PRRLPYFANEFLGLFAALWASAP 486 P RLP F +E L W+ P Sbjct: 859 PERLPSFDDECWRLMEQCWSGEP 881 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 232,285 Number of Sequences: 438 Number of extensions: 4960 Number of successful extensions: 12 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 26217432 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -