BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0943 (797 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_1576| Best HMM Match : bZIP_1 (HMM E-Value=1.1e-11) 29 4.4 SB_13633| Best HMM Match : Glyco_hydro_31 (HMM E-Value=0) 28 7.6 >SB_1576| Best HMM Match : bZIP_1 (HMM E-Value=1.1e-11) Length = 382 Score = 29.1 bits (62), Expect = 4.4 Identities = 15/45 (33%), Positives = 23/45 (51%) Frame = +3 Query: 486 VFVAERSDHKKHDNXEDKRQVRVRWSPPQGLTGEVVFRATIVKTL 620 +F + S H N DK +R+ PP G+TG+ FR + + L Sbjct: 55 LFYEQNSHMVGHHNKYDKNSMRLNLRPP-GMTGQENFRPSASRNL 98 >SB_13633| Best HMM Match : Glyco_hydro_31 (HMM E-Value=0) Length = 663 Score = 28.3 bits (60), Expect = 7.6 Identities = 10/24 (41%), Positives = 17/24 (70%) Frame = -1 Query: 641 YSDPEDLQCLDDGGAEHDLPGETL 570 Y+D ED++ +DD +HD+P + L Sbjct: 406 YNDEEDVKSVDDSFDKHDIPYDVL 429 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,216,193 Number of Sequences: 59808 Number of extensions: 461617 Number of successful extensions: 860 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 762 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 859 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2203769656 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -