BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0943 (797 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g39080.1 68415.m04802 expressed protein 30 1.5 At3g26950.1 68416.m03374 expressed protein 28 8.3 >At2g39080.1 68415.m04802 expressed protein Length = 351 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/49 (32%), Positives = 22/49 (44%), Gaps = 1/49 (2%) Frame = -1 Query: 701 NYSGSYRRRCSGYNFNWSRLY-SDPEDLQCLDDGGAEHDLPGETLGRRP 558 +Y+G R S +N S L+ S C D+G D P LG+ P Sbjct: 161 DYAGEVRNAASNWNGEGSFLFTSSSAPYDCFDNGECNEDSPVVPLGKSP 209 >At3g26950.1 68416.m03374 expressed protein Length = 548 Score = 27.9 bits (59), Expect = 8.3 Identities = 16/52 (30%), Positives = 25/52 (48%), Gaps = 5/52 (9%) Frame = +2 Query: 35 GWWXXLWENPPRVSTTTLALF-LPLK---AINAFRFEGWXS-RCNYTETLEL 175 GWW +W++P T LA F + L +N RF + S + Y T+ + Sbjct: 496 GWWDGIWQSPIPRDTRRLAAFGIELSGFGTVNEDRFHAYCSAKKEYVSTVTI 547 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,993,003 Number of Sequences: 28952 Number of extensions: 314370 Number of successful extensions: 602 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 586 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 602 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1804564000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -