BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0942 (844 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 23 4.7 AB050744-1|BAB17753.1| 238|Apis mellifera period protein protein. 23 4.7 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 22.6 bits (46), Expect = 4.7 Identities = 9/43 (20%), Positives = 22/43 (51%) Frame = -3 Query: 644 DNTVILLITRRSYNAYSYYAISVPRIIRVFPHIPDEGI*HVIF 516 + T+I + +NA Y + P +++ F ++P + + +F Sbjct: 302 EETIISSVFTTRHNATCYLSHVDPDVVQYFGYLPQDMVGRSLF 344 >AB050744-1|BAB17753.1| 238|Apis mellifera period protein protein. Length = 238 Score = 22.6 bits (46), Expect = 4.7 Identities = 9/43 (20%), Positives = 22/43 (51%) Frame = -3 Query: 644 DNTVILLITRRSYNAYSYYAISVPRIIRVFPHIPDEGI*HVIF 516 + T+I + +NA Y + P +++ F ++P + + +F Sbjct: 8 EETIISSVFTTRHNATCYLSHVDPDVVQYFGYLPQDMVGRSLF 50 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 221,319 Number of Sequences: 438 Number of extensions: 5232 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 27067071 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -