BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0932 (868 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF248052-1|AAF62184.1| 280|Caenorhabditis elegans MEI-2 protein. 34 0.15 AF039713-9|AAB96729.1| 280|Caenorhabditis elegans Defective mei... 34 0.15 U55370-2|AAA97994.1| 561|Caenorhabditis elegans Hypothetical pr... 28 7.5 >AF248052-1|AAF62184.1| 280|Caenorhabditis elegans MEI-2 protein. Length = 280 Score = 33.9 bits (74), Expect = 0.15 Identities = 24/56 (42%), Positives = 33/56 (58%), Gaps = 3/56 (5%) Frame = +1 Query: 298 KIKRQHPNIDK-LSHD-QLKYT-IQILNKFNITPLEACENAHIFCMNSITMDNYGE 456 K+K N+++ LS+D QL T I+ILN N L +C F M +IT DNYG+ Sbjct: 139 KMKSFTSNMEQILSNDNQLAPTVIRILNSRNSWCLNSCHACLTFIMENITSDNYGK 194 >AF039713-9|AAB96729.1| 280|Caenorhabditis elegans Defective meiosis protein 2 protein. Length = 280 Score = 33.9 bits (74), Expect = 0.15 Identities = 24/56 (42%), Positives = 33/56 (58%), Gaps = 3/56 (5%) Frame = +1 Query: 298 KIKRQHPNIDK-LSHD-QLKYT-IQILNKFNITPLEACENAHIFCMNSITMDNYGE 456 K+K N+++ LS+D QL T I+ILN N L +C F M +IT DNYG+ Sbjct: 139 KMKSFTSNMEQILSNDNQLAPTVIRILNSRNSWCLNSCHACLTFIMENITSDNYGK 194 >U55370-2|AAA97994.1| 561|Caenorhabditis elegans Hypothetical protein K03B4.6 protein. Length = 561 Score = 28.3 bits (60), Expect = 7.5 Identities = 18/56 (32%), Positives = 29/56 (51%) Frame = +1 Query: 289 CLEKIKRQHPNIDKLSHDQLKYTIQILNKFNITPLEACENAHIFCMNSITMDNYGE 456 CL K+++ +PN+ K + + + IQ NIT L+ A +CM I + GE Sbjct: 242 CLSKLRKTNPNLSKYTCE--NFDIQTK---NITTLKRIFTADKWCMEWIMRKHCGE 292 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,817,080 Number of Sequences: 27780 Number of extensions: 426379 Number of successful extensions: 791 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 776 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 791 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2171433726 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -