BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0930 (823 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_1434 - 33568258-33569415 29 4.5 04_04_0026 - 22222743-22222836,22223510-22223652,22224654-222246... 28 7.8 >04_04_1434 - 33568258-33569415 Length = 385 Score = 29.1 bits (62), Expect = 4.5 Identities = 13/35 (37%), Positives = 21/35 (60%) Frame = +2 Query: 548 DMDFYIFNDIIY**TTRVVYYINTIIIPKHDHAVR 652 +M FY FN I+Y R +Y +NTI + + A++ Sbjct: 132 EMPFYWFNFIVYDDADRRMYCVNTIFVVRLARAIQ 166 >04_04_0026 - 22222743-22222836,22223510-22223652,22224654-22224699, 22224916-22225043,22225178-22225285 Length = 172 Score = 28.3 bits (60), Expect = 7.8 Identities = 16/44 (36%), Positives = 23/44 (52%) Frame = +1 Query: 667 DGGATFSFRANEKESSLVDPASSKCLAPKXKPHVPSGKPY*XDT 798 DG A +A+ K+++L+DP S K L + V K Y DT Sbjct: 4 DGAAATPAKASPKKANLLDPHSIKHLLDETISDVVKSKGYAEDT 47 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,751,515 Number of Sequences: 37544 Number of extensions: 320064 Number of successful extensions: 557 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 551 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 557 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2256438528 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -