BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0928 (862 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292380-1|CAL23192.2| 489|Tribolium castaneum gustatory recept... 23 4.1 EF592536-1|ABQ95982.1| 598|Tribolium castaneum beta-N-acetylglu... 21 9.5 EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 p... 21 9.5 AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax pr... 21 9.5 >AM292380-1|CAL23192.2| 489|Tribolium castaneum gustatory receptor candidate 59 protein. Length = 489 Score = 22.6 bits (46), Expect = 4.1 Identities = 7/27 (25%), Positives = 18/27 (66%) Frame = -3 Query: 485 ELIILCGVFAVVFLSLNMWLSVLEYCH 405 ++ I C +F V+ L ++ +L+ + +C+ Sbjct: 131 QIFITCELFFVILLWISFFLNFMLHCN 157 >EF592536-1|ABQ95982.1| 598|Tribolium castaneum beta-N-acetylglucosaminidase NAG1 protein. Length = 598 Score = 21.4 bits (43), Expect = 9.5 Identities = 8/21 (38%), Positives = 11/21 (52%) Frame = +2 Query: 140 NIAGRSGNWTSETSPTFCLKA 202 NI+ +G W E +C KA Sbjct: 17 NISALNGAWRWECKSNYCQKA 37 >EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 protein. Length = 535 Score = 21.4 bits (43), Expect = 9.5 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = -2 Query: 48 VRSARWMRISCSSMY 4 V + WM +SCSS + Sbjct: 405 VNAGMWMWLSCSSFF 419 >AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax protein. Length = 297 Score = 21.4 bits (43), Expect = 9.5 Identities = 10/34 (29%), Positives = 13/34 (38%) Frame = +2 Query: 587 NFNNKIDLEXLFXTFHGICNTNAEKQSLCPHNYE 688 +FN + H +C TN S PH E Sbjct: 240 HFNRYLTRRRRIEIAHALCLTNKNLVSKPPHEVE 273 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 197,328 Number of Sequences: 336 Number of extensions: 4208 Number of successful extensions: 7 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 23866870 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -