BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0928 (862 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC1840.05c |||phosphomannomutase |Schizosaccharomyces pombe|ch... 28 2.0 SPBC1604.15 |gpi16||pig-T |Schizosaccharomyces pombe|chr 2|||Manual 27 4.5 >SPCC1840.05c |||phosphomannomutase |Schizosaccharomyces pombe|chr 3|||Manual Length = 587 Score = 27.9 bits (59), Expect = 2.0 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = +3 Query: 639 YVIPMXRSSLFVPTIMRIASF*EVQTIGGFWWL 737 YV+ SS V ++ ++ F V+T+ GF WL Sbjct: 353 YVLSTTVSSAMVKSMAKVEGFHHVETLTGFKWL 385 >SPBC1604.15 |gpi16||pig-T |Schizosaccharomyces pombe|chr 2|||Manual Length = 545 Score = 26.6 bits (56), Expect = 4.5 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = -2 Query: 495 FSWGINYSLWSFRCSIPFFKYVVKCLGVLS 406 +S G+ + +W+F + P KY +K LS Sbjct: 109 YSGGLGFEVWAFMANDPSMKYWLKLTNQLS 138 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,353,391 Number of Sequences: 5004 Number of extensions: 65367 Number of successful extensions: 146 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 141 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 146 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 428468660 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -