BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0927 (878 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value L23651-11|AAA27959.1| 250|Caenorhabditis elegans Hypothetical p... 30 2.5 Z68160-4|CAA92292.1| 583|Caenorhabditis elegans Hypothetical pr... 28 7.7 >L23651-11|AAA27959.1| 250|Caenorhabditis elegans Hypothetical protein C29E4.7 protein. Length = 250 Score = 29.9 bits (64), Expect = 2.5 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = +2 Query: 269 TXHHQPAAPPTHNDEKPVVECSFITEFEDHIF 364 T H+Q AP ++ K V+E FI E+ D F Sbjct: 66 TKHYQGKAPAVEHNGKVVIESGFIPEYLDDAF 97 >Z68160-4|CAA92292.1| 583|Caenorhabditis elegans Hypothetical protein D1046.4 protein. Length = 583 Score = 28.3 bits (60), Expect = 7.7 Identities = 14/34 (41%), Positives = 17/34 (50%), Gaps = 3/34 (8%) Frame = +2 Query: 281 QPAAPPTHNDEKPVVE---CSFITEFEDHIFVSV 373 +P PP D PV C F T F+D I VS+ Sbjct: 498 EPPQPPRPEDIAPVSHPRPCQFSTSFDDEIVVSI 531 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,292,721 Number of Sequences: 27780 Number of extensions: 252350 Number of successful extensions: 635 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 624 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 635 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2213393798 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -