BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0925 (859 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ302654-1|CAC35519.1| 168|Anopheles gambiae gSG2-like protein ... 29 0.18 AJ278310-1|CAB93496.1| 219|Anopheles gambiae serine protease-li... 24 6.8 AJ130951-1|CAA10260.1| 189|Anopheles gambiae SG3 protein protein. 24 6.8 >AJ302654-1|CAC35519.1| 168|Anopheles gambiae gSG2-like protein protein. Length = 168 Score = 29.1 bits (62), Expect = 0.18 Identities = 16/42 (38%), Positives = 24/42 (57%) Frame = +1 Query: 253 GGHQTSXESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGG 378 GG Q S+G+G+ +P + G G +SG +FGN +GG Sbjct: 122 GGGQGGIPSFGSGQQNGGVPFL-GNGQGQSGFPSFGNGQQGG 162 >AJ278310-1|CAB93496.1| 219|Anopheles gambiae serine protease-like protein protein. Length = 219 Score = 23.8 bits (49), Expect = 6.8 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = -1 Query: 295 HVRYPMIRXWFGDHL 251 +V PM R W DHL Sbjct: 192 YVNVPMFRGWIDDHL 206 >AJ130951-1|CAA10260.1| 189|Anopheles gambiae SG3 protein protein. Length = 189 Score = 23.8 bits (49), Expect = 6.8 Identities = 12/31 (38%), Positives = 14/31 (45%) Frame = -3 Query: 380 RPPRHMLPKAP*PDLWVPPPRTRGIRATARP 288 RPP H P W+ PP R +TA P Sbjct: 93 RPPWHPRPPFGGRPWWLRPPFHRPTTSTAAP 123 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 670,195 Number of Sequences: 2352 Number of extensions: 10283 Number of successful extensions: 24 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 91372671 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -