BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0924 (868 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY957503-1|AAY41942.1| 596|Anopheles gambiae vasa-like protein ... 50 1e-07 EF519370-1|ABP68479.1| 452|Anopheles gambiae LRIM1 protein. 27 0.74 AY534996-1|AAT07394.1| 471|Anopheles gambiae XK-related b protein. 25 3.0 >AY957503-1|AAY41942.1| 596|Anopheles gambiae vasa-like protein protein. Length = 596 Score = 49.6 bits (113), Expect = 1e-07 Identities = 29/73 (39%), Positives = 40/73 (54%), Gaps = 1/73 (1%) Frame = +1 Query: 364 EVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIASLERI*LA-YQT 540 +V VSG + ++ FE + + V V+ Y +PTPIQ PI R +A QT Sbjct: 161 QVRVSGENPPDHVESFERSGLREEVMTNVRKSSYTKPTPIQRYAIPIILNGRDLMACAQT 220 Query: 541 GSGKTLAYILPAI 579 GSGKT A++LP I Sbjct: 221 GSGKTAAFMLPMI 233 >EF519370-1|ABP68479.1| 452|Anopheles gambiae LRIM1 protein. Length = 452 Score = 27.1 bits (57), Expect = 0.74 Identities = 14/40 (35%), Positives = 22/40 (55%) Frame = +2 Query: 116 TVVPNLEEATNSAIILLDLATVAIDLEDLEDLVGKKNSLE 235 T++ +L+E S + LDL ID +L +L +SLE Sbjct: 140 TMLRDLDEGCRSRVQYLDLKLNEIDTVNLAELAASSDSLE 179 >AY534996-1|AAT07394.1| 471|Anopheles gambiae XK-related b protein. Length = 471 Score = 25.0 bits (52), Expect = 3.0 Identities = 14/47 (29%), Positives = 22/47 (46%) Frame = -2 Query: 165 RRIIAEFVASSKFGTTVSTAIIPVTRHDYFSDLVEDVYLNYGFFLTQ 25 RR+ A+ A ++F ++ YF D+V DV L Y + Q Sbjct: 59 RRVRAKSKAMTEFLPLCDVLFNVISLAGYFCDVVFDVVLGYALYERQ 105 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 847,664 Number of Sequences: 2352 Number of extensions: 17158 Number of successful extensions: 36 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 34 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 35 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 92613024 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -