BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0924 (868 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. 62 6e-12 >DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. Length = 630 Score = 62.1 bits (144), Expect = 6e-12 Identities = 34/76 (44%), Positives = 44/76 (57%), Gaps = 1/76 (1%) Frame = +1 Query: 355 NNHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIASLERI*LA- 531 +N +V VSG V PI+ FE A + V +K GYK+PTP+Q PI R +A Sbjct: 180 DNIQVNVSGDNVPQPIESFEAAGLRNIVLDNIKKSGYKKPTPVQKHALPIIMNGRDLMAC 239 Query: 532 YQTGSGKTLAYILPAI 579 QTGSGKT A+ +P I Sbjct: 240 AQTGSGKTAAFAVPII 255 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 225,155 Number of Sequences: 438 Number of extensions: 5024 Number of successful extensions: 8 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 28038087 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -