BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0923 (805 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Y17701-1|CAA76821.1| 81|Anopheles gambiae apyrase protein. 25 3.6 AJ237705-1|CAB40346.1| 557|Anopheles gambiae putative apyrase p... 25 3.6 AJ237704-1|CAB40345.1| 557|Anopheles gambiae apyrase protein. 25 3.6 AB090823-1|BAC57921.1| 429|Anopheles gambiae gag-like protein p... 24 6.3 >Y17701-1|CAA76821.1| 81|Anopheles gambiae apyrase protein. Length = 81 Score = 24.6 bits (51), Expect = 3.6 Identities = 14/41 (34%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = -3 Query: 266 PSQNELGKXCDLTVLSQFQLHGNRAXCF-HSPGSEAADSDT 147 P Q +LG+ LT++ LH A S +AA+ DT Sbjct: 28 PDQRQLGELFPLTIIHMNDLHARFAETSERSSKCKAAEGDT 68 >AJ237705-1|CAB40346.1| 557|Anopheles gambiae putative apyrase protein. Length = 557 Score = 24.6 bits (51), Expect = 3.6 Identities = 14/41 (34%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = -3 Query: 266 PSQNELGKXCDLTVLSQFQLHGNRAXCF-HSPGSEAADSDT 147 P Q +LG+ LT++ LH A S +AA+ DT Sbjct: 28 PDQRQLGELFPLTIIHMNDLHARFAETSERSSKCKAAEGDT 68 >AJ237704-1|CAB40345.1| 557|Anopheles gambiae apyrase protein. Length = 557 Score = 24.6 bits (51), Expect = 3.6 Identities = 14/41 (34%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = -3 Query: 266 PSQNELGKXCDLTVLSQFQLHGNRAXCF-HSPGSEAADSDT 147 P Q +LG+ LT++ LH A S +AA+ DT Sbjct: 28 PDQRQLGELFPLTIIHMNDLHARFAETSERSSKCKAAEGDT 68 >AB090823-1|BAC57921.1| 429|Anopheles gambiae gag-like protein protein. Length = 429 Score = 23.8 bits (49), Expect = 6.3 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = +2 Query: 347 IEEQVAIIYCGVRGHLDK 400 ++ Q A I CG GHL K Sbjct: 381 VDRQKACIRCGAEGHLAK 398 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 734,096 Number of Sequences: 2352 Number of extensions: 13019 Number of successful extensions: 36 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 34 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 36 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 84823812 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -