BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0920 (838 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC065370-1|AAH65370.1| 398|Homo sapiens C20orf112 protein protein. 31 3.9 >BC065370-1|AAH65370.1| 398|Homo sapiens C20orf112 protein protein. Length = 398 Score = 31.5 bits (68), Expect = 3.9 Identities = 22/80 (27%), Positives = 33/80 (41%) Frame = +3 Query: 303 LQHDEETDPGGSGRVNPVLSHGGLLLDRYGEPPRLREXFFDAATEEREHATKLIDYLLMR 482 + H + P S +PV ++GGL G A+ + H+ D + Sbjct: 313 ITHSTYSLPASSYSQDPVYANGGLNYSYRGYGALSSNLQPPASLQTGNHSNGPTDLSMKG 372 Query: 483 GKLTGSVTDSSRTGPPQTRR 542 G T S T S+ +G P TRR Sbjct: 373 GASTTSTTPSALSGEPPTRR 392 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 105,983,926 Number of Sequences: 237096 Number of extensions: 2056038 Number of successful extensions: 4143 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 3946 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4140 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 10538170902 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -