BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0918 (855 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_42548| Best HMM Match : DNA_binding_1 (HMM E-Value=5.2) 46 3e-05 SB_56373| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.6 >SB_42548| Best HMM Match : DNA_binding_1 (HMM E-Value=5.2) Length = 101 Score = 46.4 bits (105), Expect = 3e-05 Identities = 23/58 (39%), Positives = 33/58 (56%) Frame = +1 Query: 280 LFISSVAAQKAASNGFEIKAYDFPARKEECRKPRIVRLGLIQHSIAISTDNPITQQRL 453 L + + A AA FE+ Y A EE R+PR+VR+G +Q+ I T+ PI +Q L Sbjct: 36 LSLPAAAVSVAAELDFELAGYKIDAAAEELRQPRLVRIGAVQNKIVEPTNMPIAKQVL 93 >SB_56373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 629 Score = 30.7 bits (66), Expect = 1.6 Identities = 18/55 (32%), Positives = 26/55 (47%) Frame = +1 Query: 301 AQKAASNGFEIKAYDFPARKEECRKPRIVRLGLIQHSIAISTDNPITQQRLAIFE 465 A+ N F + Y A ++EC K + L SIAI+ N +T + LA E Sbjct: 246 AELEKKNSFTLLHYAAQAGQQECLKYLLTALRGANRSIAITDSNGVTPEHLAARE 300 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,587,252 Number of Sequences: 59808 Number of extensions: 446547 Number of successful extensions: 668 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 630 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 668 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2431332827 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -