BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0914 (833 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_26973| Best HMM Match : DUF471 (HMM E-Value=1.1) 30 2.7 SB_17245| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.6 SB_14436| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 SB_2181| Best HMM Match : RGS (HMM E-Value=0.11) 29 6.1 SB_12387| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 >SB_26973| Best HMM Match : DUF471 (HMM E-Value=1.1) Length = 674 Score = 29.9 bits (64), Expect = 2.7 Identities = 12/22 (54%), Positives = 15/22 (68%), Gaps = 3/22 (13%) Frame = -2 Query: 718 VILSGDPKIHNWRYH---HYYW 662 V+ SGDPK H W YH HY++ Sbjct: 250 VVYSGDPKHHLWLYHTGDHYHY 271 >SB_17245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 442 Score = 29.1 bits (62), Expect = 4.6 Identities = 17/63 (26%), Positives = 29/63 (46%) Frame = -2 Query: 400 HSILC*GS*VFGTRFFTLI*IPIIICKRHFVLTNNRLVLIYTSVTIGFILFVRLGIKFSV 221 HS+ +F TR+ +P+ IC F + ++ Y I +LFV + F++ Sbjct: 97 HSLFAISHSLFATRY-----LPLAICHSLFAICHSLFATRYLPFAICHLLFVTRYLPFAI 151 Query: 220 CLS 212 C S Sbjct: 152 CHS 154 >SB_14436| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 765 Score = 28.7 bits (61), Expect = 6.1 Identities = 12/40 (30%), Positives = 22/40 (55%) Frame = +3 Query: 141 ENPSQRPEHRDPQDYTALNERKSQDKHTENLIPNLTNSIN 260 ++ +Q P HR PQ+Y+ ++S+ + + P L N N Sbjct: 85 DSRNQHPNHRIPQNYSLRTIKRSEIRGSTGSPPTLANEDN 124 >SB_2181| Best HMM Match : RGS (HMM E-Value=0.11) Length = 1313 Score = 28.7 bits (61), Expect = 6.1 Identities = 20/80 (25%), Positives = 39/80 (48%), Gaps = 4/80 (5%) Frame = +2 Query: 287 DESIVS--QDKVAFTNDNGNLYQSKESRSENSGTSTQDTVPKIIYVQTDGLQDNQLYQ-- 454 DES+ Q+K N+N +L Q+K ++ E+ + ++ P V T+ Q+ + Sbjct: 37 DESVHQSVQEKSEIENNNDSLSQNKVTKYEDKESQDSNSNPHRTQVNTESKQETCAGEEG 96 Query: 455 VAGSSGDSIIMSRAQTNKVP 514 A + DS+ +++ VP Sbjct: 97 TATENSDSVNIAQPSPGAVP 116 >SB_12387| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1096 Score = 28.3 bits (60), Expect = 8.1 Identities = 14/52 (26%), Positives = 24/52 (46%), Gaps = 3/52 (5%) Frame = +3 Query: 93 IIERRNHKVPHDLRNVE---NPSQRPEHRDPQDYTALNERKSQDKHTENLIP 239 +I+ HK P D +PS +H P DY+ Q +T++++P Sbjct: 891 LIDELTHKAPLDYSRAPRYGDPSINTQHMVPLDYSQAPRYCDQSMNTQHMVP 942 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,927,521 Number of Sequences: 59808 Number of extensions: 432062 Number of successful extensions: 1202 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1056 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1201 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2347493764 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -