BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0913 (816 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_01_0337 - 2519732-2521093 30 2.5 12_01_1059 - 10934937-10935446,10938224-10938271,10938383-109386... 29 4.4 >11_01_0337 - 2519732-2521093 Length = 453 Score = 29.9 bits (64), Expect = 2.5 Identities = 12/39 (30%), Positives = 21/39 (53%) Frame = +2 Query: 116 DTLAAMLEVTKLLFHHPPNHNGYSELSLSTYSHQESLDH 232 D +AA +E T L+FH P H+ ++ + + H + H Sbjct: 204 DLVAAAVEYTSLIFHLPNKHSSWARTNPNICCHDIAFHH 242 >12_01_1059 - 10934937-10935446,10938224-10938271,10938383-10938619, 10938711-10938747,10941018-10941286 Length = 366 Score = 29.1 bits (62), Expect = 4.4 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = -2 Query: 302 IYILFFDLSFNFKVNLLASNL*EYGQ 225 +Y LF LSFN +VN+L + YGQ Sbjct: 73 LYQLFLHLSFNLRVNVLGYDYSGYGQ 98 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,684,334 Number of Sequences: 37544 Number of extensions: 274446 Number of successful extensions: 395 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 392 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 395 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2232933960 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -