BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0911 (810 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q4YJS4 Cluster: Putative uncharacterized protein; n=1; ... 34 3.7 UniRef50_Q5C0E7 Cluster: SJCHGC00901 protein; n=2; Schistosoma j... 33 6.4 UniRef50_UPI00006CCA52 Cluster: TPR Domain containing protein; n... 33 8.5 >UniRef50_Q4YJS4 Cluster: Putative uncharacterized protein; n=1; Plasmodium berghei|Rep: Putative uncharacterized protein - Plasmodium berghei Length = 156 Score = 34.3 bits (75), Expect = 3.7 Identities = 19/51 (37%), Positives = 31/51 (60%), Gaps = 3/51 (5%) Frame = -3 Query: 562 AFVFIYRIL---FHEENFKICLHKTLFLDNYLIYLHIFH*KICVFIGFCRL 419 +F+FI RI+ F +++F I L + L+Y H++ K+CVFI F +L Sbjct: 90 SFIFIKRIIYKIFFDQDFIISLQHHRIAE--LLYTHVYGDKVCVFIHFKKL 138 >UniRef50_Q5C0E7 Cluster: SJCHGC00901 protein; n=2; Schistosoma japonicum|Rep: SJCHGC00901 protein - Schistosoma japonicum (Blood fluke) Length = 358 Score = 33.5 bits (73), Expect = 6.4 Identities = 17/45 (37%), Positives = 26/45 (57%) Frame = -3 Query: 574 TQYTAFVFIYRILFHEENFKICLHKTLFLDNYLIYLHIFH*KICV 440 ++YT F+ +Y L E N HKT F+DN + L+I H K+ + Sbjct: 170 SRYTGFLPLYARLELEANLYRINHKTDFIDNNQVQLYIDHIKLLI 214 >UniRef50_UPI00006CCA52 Cluster: TPR Domain containing protein; n=1; Tetrahymena thermophila SB210|Rep: TPR Domain containing protein - Tetrahymena thermophila SB210 Length = 3418 Score = 33.1 bits (72), Expect = 8.5 Identities = 20/57 (35%), Positives = 28/57 (49%) Frame = +1 Query: 463 YVNKLNNYLKIVSYEDKF*NFLHEIIFCR*KQKQYIA**AYVIYSVNINLLKAKFPY 633 + +LN LK +SY K +LH I C+ Q+ Y Y SV I+ AK+ Y Sbjct: 3213 HAKELNALLKALSYSPKNAKYLHNIGICQRLQENYQEALIYFKQSVQIDSENAKYYY 3269 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 701,365,984 Number of Sequences: 1657284 Number of extensions: 12866991 Number of successful extensions: 21173 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 20491 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21170 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 69966202150 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -