BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0911 (810 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY051753-1|AAK93177.1| 1014|Drosophila melanogaster LD28893p pro... 31 1.4 AE014298-1934|AAF48296.2| 1384|Drosophila melanogaster CG2691-PA... 31 1.4 >AY051753-1|AAK93177.1| 1014|Drosophila melanogaster LD28893p protein. Length = 1014 Score = 31.5 bits (68), Expect = 1.4 Identities = 18/64 (28%), Positives = 32/64 (50%) Frame = -1 Query: 774 YFKQQLITILVYIQILNFSDCIGNENSQEQHIEEKLCLQLWNF*VRLIGKFCFQ*INVHR 595 +FK++++ + + Q L + + +N+ HI E LC QLW L FC Q + Sbjct: 243 FFKEKIVALAMDCQ-LKWKEFAEAKNNSSSHIYELLCCQLWG----LFPGFCRQPRDPEY 297 Query: 594 INYI 583 + Y+ Sbjct: 298 LRYL 301 >AE014298-1934|AAF48296.2| 1384|Drosophila melanogaster CG2691-PA protein. Length = 1384 Score = 31.5 bits (68), Expect = 1.4 Identities = 18/64 (28%), Positives = 32/64 (50%) Frame = -1 Query: 774 YFKQQLITILVYIQILNFSDCIGNENSQEQHIEEKLCLQLWNF*VRLIGKFCFQ*INVHR 595 +FK++++ + + Q L + + +N+ HI E LC QLW L FC Q + Sbjct: 613 FFKEKIVALAMDCQ-LKWKEFAEAKNNSSSHIYELLCCQLWG----LFPGFCRQPRDPEY 667 Query: 594 INYI 583 + Y+ Sbjct: 668 LRYL 671 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 31,031,577 Number of Sequences: 53049 Number of extensions: 578625 Number of successful extensions: 1030 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1016 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1030 length of database: 24,988,368 effective HSP length: 84 effective length of database: 20,532,252 effective search space used: 3798466620 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -