BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0911 (810 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U53148-2|AAB37078.1| 360|Caenorhabditis elegans Hypothetical pr... 28 6.9 AL110478-12|CAM33509.1| 108|Caenorhabditis elegans Hypothetical... 28 6.9 >U53148-2|AAB37078.1| 360|Caenorhabditis elegans Hypothetical protein C26F1.6 protein. Length = 360 Score = 28.3 bits (60), Expect = 6.9 Identities = 18/84 (21%), Positives = 42/84 (50%), Gaps = 4/84 (4%) Frame = -3 Query: 697 FTRTAYRRKTVLTIMEFLSTLDREI-LLSVN*CSQNKLHRL---TTQYTAFVFIYRILFH 530 +TR +R+K++ ++ LS D + +L++ + +L ++ T V++Y + Sbjct: 31 YTRKTFRKKSINVLLAALSMSDLCVCVLAIPVFASTQLQQVIPPTITAMIMVYLYPVTIM 90 Query: 529 EENFKICLHKTLFLDNYLIYLHIF 458 ++ + L ++ +D YL H F Sbjct: 91 FQSVSVWLLVSITIDRYLAVCHPF 114 >AL110478-12|CAM33509.1| 108|Caenorhabditis elegans Hypothetical protein Y26D4A.17 protein. Length = 108 Score = 28.3 bits (60), Expect = 6.9 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +2 Query: 272 SYKMVCITCPMYITETHAPVKAARLFF 352 +YK V + PMY TE P+K ++ F Sbjct: 6 NYKRVALLDPMYTTEPKTPIKLEKIKF 32 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,818,783 Number of Sequences: 27780 Number of extensions: 326664 Number of successful extensions: 580 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 554 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 569 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1987863822 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -