BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0910 (855 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z92803-13|CAB07249.2| 331|Caenorhabditis elegans Hypothetical p... 31 1.4 AL021482-4|CAA16341.2| 331|Caenorhabditis elegans Hypothetical ... 31 1.4 >Z92803-13|CAB07249.2| 331|Caenorhabditis elegans Hypothetical protein K01G5.9 protein. Length = 331 Score = 30.7 bits (66), Expect = 1.4 Identities = 16/47 (34%), Positives = 24/47 (51%) Frame = +3 Query: 186 IKYEGVCSHRCLSGSGCAGRGRLCYQNVDQGCRRTLSLPHCSAYYGQ 326 +K+ G H C+ GSG R + DQ RT+S+ CS +G+ Sbjct: 182 LKHSGRLGHSCVYGSGTWSERRQYEEPFDQVSERTISI--CSTGHGE 226 >AL021482-4|CAA16341.2| 331|Caenorhabditis elegans Hypothetical protein K01G5.9 protein. Length = 331 Score = 30.7 bits (66), Expect = 1.4 Identities = 16/47 (34%), Positives = 24/47 (51%) Frame = +3 Query: 186 IKYEGVCSHRCLSGSGCAGRGRLCYQNVDQGCRRTLSLPHCSAYYGQ 326 +K+ G H C+ GSG R + DQ RT+S+ CS +G+ Sbjct: 182 LKHSGRLGHSCVYGSGTWSERRQYEEPFDQVSERTISI--CSTGHGE 226 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,960,163 Number of Sequences: 27780 Number of extensions: 339024 Number of successful extensions: 847 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 805 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 847 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2129473654 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -