BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0910 (855 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase p... 23 4.7 DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex det... 22 8.3 DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex det... 22 8.3 DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex det... 22 8.3 DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex det... 22 8.3 DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex det... 22 8.3 DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex det... 22 8.3 DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex det... 22 8.3 >EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase protein. Length = 620 Score = 22.6 bits (46), Expect = 4.7 Identities = 16/68 (23%), Positives = 25/68 (36%) Frame = +3 Query: 291 LSLPHCSAYYGQFKDNHVVANELKALASLYLKRSYHYLLSASYFNNYQTNREGFAXFFRK 470 L P + G F+ + + +L + + HYL + S NY + F K Sbjct: 541 LGKPSRISKQGLFRRFYNLLGKLSTIEDADKNQCRHYLDAKSSVQNYSLAKHQLKEAFVK 600 Query: 471 LSDDSWEK 494 SW K Sbjct: 601 AHLGSWVK 608 >DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.8 bits (44), Expect = 8.3 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 Query: 381 LKRSYHYLLSASYFNNYQTN 440 L +Y Y +Y NNY TN Sbjct: 85 LSNNYKYSNYNNYNNNYNTN 104 >DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.8 bits (44), Expect = 8.3 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 Query: 381 LKRSYHYLLSASYFNNYQTN 440 L +Y Y +Y NNY TN Sbjct: 85 LSNNYKYSNYNNYNNNYNTN 104 >DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.8 bits (44), Expect = 8.3 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 Query: 381 LKRSYHYLLSASYFNNYQTN 440 L +Y Y +Y NNY TN Sbjct: 85 LSNNYKYSNYNNYNNNYNTN 104 >DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.8 bits (44), Expect = 8.3 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 Query: 381 LKRSYHYLLSASYFNNYQTN 440 L +Y Y +Y NNY TN Sbjct: 85 LSNNYKYSNYNNYNNNYNTN 104 >DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.8 bits (44), Expect = 8.3 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 Query: 381 LKRSYHYLLSASYFNNYQTN 440 L +Y Y +Y NNY TN Sbjct: 85 LSNNYKYSNYNNYNNNYNTN 104 >DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.8 bits (44), Expect = 8.3 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 Query: 381 LKRSYHYLLSASYFNNYQTN 440 L +Y Y +Y NNY TN Sbjct: 85 LSNNYKYSNYNNYNNNYNTN 104 >DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.8 bits (44), Expect = 8.3 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 Query: 381 LKRSYHYLLSASYFNNYQTN 440 L +Y Y +Y NNY TN Sbjct: 85 LSNNYKYSNYNNYNNNYNTN 104 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 209,508 Number of Sequences: 438 Number of extensions: 4369 Number of successful extensions: 12 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 27552579 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -