BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0909 (847 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q182E0 Cluster: Putative uncharacterized protein; n=2; ... 38 0.32 UniRef50_UPI0000EBDC1B Cluster: PREDICTED: hypothetical protein;... 36 0.97 UniRef50_Q965R1 Cluster: Putative uncharacterized protein; n=1; ... 36 1.7 UniRef50_Q1FGN9 Cluster: Binding-protein-dependent transport sys... 34 5.2 UniRef50_Q4UA59 Cluster: SfiI-subtelomeric related protein famil... 34 5.2 UniRef50_A0C752 Cluster: Chromosome undetermined scaffold_154, w... 34 5.2 UniRef50_Q23CM8 Cluster: Cyclic nucleotide-binding domain contai... 33 6.8 UniRef50_Q2HBZ5 Cluster: Putative uncharacterized protein; n=1; ... 33 6.8 >UniRef50_Q182E0 Cluster: Putative uncharacterized protein; n=2; Clostridium difficile|Rep: Putative uncharacterized protein - Clostridium difficile (strain 630) Length = 491 Score = 37.9 bits (84), Expect = 0.32 Identities = 22/72 (30%), Positives = 35/72 (48%), Gaps = 3/72 (4%) Frame = -1 Query: 262 RSEMYKTVLCFEKFFTTFFSRLYGNTNFGQIL---RELRQS*LLQYKLFCSYRLYTPKSF 92 RS ++ +CFE F LY N + +LR+ L +K+ ++Y+ KSF Sbjct: 218 RSGQVESNICFECEFFNLMCLLYINLKRPMVFAYTNDLRELAFLNHKIMLKRKMYSDKSF 277 Query: 91 YSSCINRKISII 56 Y ++ KIS I Sbjct: 278 YKKLLHEKISSI 289 >UniRef50_UPI0000EBDC1B Cluster: PREDICTED: hypothetical protein; n=1; Bos taurus|Rep: PREDICTED: hypothetical protein - Bos taurus Length = 231 Score = 36.3 bits (80), Expect = 0.97 Identities = 22/64 (34%), Positives = 30/64 (46%) Frame = -3 Query: 836 AGGCPQTX*EPRLKATMRWYRGKRAQPLDAAPQLSPLGDWSXPPIGPNCTRLCSPFSVCT 657 AG P+ +P + +RW RG+R + A LG+ S PP P C P + Sbjct: 135 AGRAPRAPKQPCAQLYLRWKRGRRGR----ADPSGTLGERSLPPAAPRSPCGCGPRPL-- 188 Query: 656 GRVW 645 GRVW Sbjct: 189 GRVW 192 >UniRef50_Q965R1 Cluster: Putative uncharacterized protein; n=1; Caenorhabditis elegans|Rep: Putative uncharacterized protein - Caenorhabditis elegans Length = 588 Score = 35.5 bits (78), Expect = 1.7 Identities = 26/93 (27%), Positives = 47/93 (50%), Gaps = 5/93 (5%) Frame = +1 Query: 280 KLLFWLKSGGGTK--SPLGQLVRKQT-DHRTINKKATTSVIEL*NRKDFGNIFKS--LRE 444 K +FW++ ++ S QL+ D+ T ++ +++ + D + + LRE Sbjct: 443 KTIFWVRIDNSSEQDSRSKQLIEPMYFDNSTAKIISSRTILSI--EDDLRRMMRKPKLRE 500 Query: 445 LFIS*PKIHSEFVDLIYSCYSDQFPKKHQEIRI 543 +F + P IH F DLI CY+D++ + H RI Sbjct: 501 IFKNLPNIHY-FTDLIVKCYNDRYYRYHYSGRI 532 >UniRef50_Q1FGN9 Cluster: Binding-protein-dependent transport systems inner membrane component; n=1; Clostridium phytofermentans ISDg|Rep: Binding-protein-dependent transport systems inner membrane component - Clostridium phytofermentans ISDg Length = 197 Score = 33.9 bits (74), Expect = 5.2 Identities = 17/55 (30%), Positives = 28/55 (50%) Frame = -2 Query: 282 F*TQFPIAAKCTKQSFVSKSFLQPFFRVYTETQILVKFCANCVKVNFYNTNFFVV 118 F T +P T Q +++ +FL+ ++ + +L + VNFYNTNF V Sbjct: 140 FSTNYPPNHSYTLQYYMNNNFLKLDYQSLATSAVLTSVLVFVIVVNFYNTNFNTV 194 >UniRef50_Q4UA59 Cluster: SfiI-subtelomeric related protein family member, putative; n=1; Theileria annulata|Rep: SfiI-subtelomeric related protein family member, putative - Theileria annulata Length = 529 Score = 33.9 bits (74), Expect = 5.2 Identities = 14/46 (30%), Positives = 26/46 (56%) Frame = +1 Query: 61 LKFYDLYN*NKNFLEYKVDNYKKVCIVEVNFDAVRAEFDQNLCFRI 198 L F D N + N+L+ V+ Y+ + ++E F+ + FD LC+ + Sbjct: 47 LLFTDSNNKDYNYLQCSVELYELILVIEFGFNCKKVWFDSKLCWTL 92 >UniRef50_A0C752 Cluster: Chromosome undetermined scaffold_154, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_154, whole genome shotgun sequence - Paramecium tetraurelia Length = 708 Score = 33.9 bits (74), Expect = 5.2 Identities = 27/96 (28%), Positives = 44/96 (45%) Frame = +2 Query: 248 VHFAAIGNCVQNYCFGLNLEGEQNRLLAN*FGNKLITER*TKKQRPQ*LNYKIARILETS 427 ++F I NC+ CF L EG+ N L++N G I ++ K + Q I + + Sbjct: 66 LYFTFIKNCIFLLCFHLMAEGQFN-LISNYQGEDCIPKKRVKFETDQECVRDIVTMFSLA 124 Query: 428 SKVFVNFSSANLKFTVSSSTLYIRATVISFQRNIKK 535 ++ A SST + A +I F++N KK Sbjct: 125 NRRKDQELQALQDILTLSSTFLMMAFLIYFRKNQKK 160 >UniRef50_Q23CM8 Cluster: Cyclic nucleotide-binding domain containing protein; n=1; Tetrahymena thermophila SB210|Rep: Cyclic nucleotide-binding domain containing protein - Tetrahymena thermophila SB210 Length = 913 Score = 33.5 bits (73), Expect = 6.8 Identities = 28/105 (26%), Positives = 52/105 (49%), Gaps = 11/105 (10%) Frame = -3 Query: 299 LSQNSNFEHNFLSQRNVQNSPLFRKVFYNLFFASIRKHKFWSNS---ARTASKLTSTIQ- 132 ++Q +NF+ + +Q+N++ + +VF N +F I++ + + + SK+ IQ Sbjct: 777 ITQETNFQSFYPNQKNLEQFVIRSQVFENQYFERIQQKQLKYSPEIYEQKQSKILDFIQQ 836 Query: 131 ---TFL*LSTLYSKKFLF*LYKS*NFNNK----SQRQRPRKTHHT 18 FL + K Y + NFNN Q+Q+PR+T H+ Sbjct: 837 FEWEFLEMQLFDKIKNFQYYYPTFNFNNVIKKIKQQQQPRRTIHS 881 >UniRef50_Q2HBZ5 Cluster: Putative uncharacterized protein; n=1; Chaetomium globosum|Rep: Putative uncharacterized protein - Chaetomium globosum (Soil fungus) Length = 364 Score = 33.5 bits (73), Expect = 6.8 Identities = 20/58 (34%), Positives = 27/58 (46%) Frame = -1 Query: 835 PADAPRRSKSPGLRPRCAGTGESAHSHWMLLPSXAHLETGVXHRLVPIAPAYVPHSAS 662 P RR++ L P G HW LLP HL + R +P+ PA++PH S Sbjct: 160 PLPLVRRAEMQHLPPVLTTHGHQLPQHWHLLPK--HLPRRL--RRLPLLPAHLPHQRS 213 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 852,735,886 Number of Sequences: 1657284 Number of extensions: 17495789 Number of successful extensions: 48848 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 46748 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 48835 length of database: 575,637,011 effective HSP length: 100 effective length of database: 409,908,611 effective search space used: 74193458591 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -