BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0909 (847 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292353-1|CAL23165.2| 651|Tribolium castaneum gustatory recept... 23 3.0 EF592538-1|ABQ95984.1| 582|Tribolium castaneum beta-N-acetylglu... 22 5.3 AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicas... 22 5.3 >AM292353-1|CAL23165.2| 651|Tribolium castaneum gustatory receptor candidate 32 protein. Length = 651 Score = 23.0 bits (47), Expect = 3.0 Identities = 11/40 (27%), Positives = 18/40 (45%) Frame = -2 Query: 273 QFPIAAKCTKQSFVSKSFLQPFFRVYTETQILVKFCANCV 154 QF + T +FVS F PF+ +LV+ + + Sbjct: 348 QFEMTQNSTNINFVSTFFKIPFYSTLRPINLLVQIILDVI 387 >EF592538-1|ABQ95984.1| 582|Tribolium castaneum beta-N-acetylglucosaminidase NAG3 protein. Length = 582 Score = 22.2 bits (45), Expect = 5.3 Identities = 21/81 (25%), Positives = 35/81 (43%), Gaps = 4/81 (4%) Frame = -1 Query: 277 NTISYRSEMYKTVLCFEKFFTTFFSRLYG----NTNFGQILRELRQS*LLQYKLFCSYRL 110 N S R++ +T F F+ F + Y N + L E ++ L + CS Sbjct: 19 NVSSTRTKYLRTN--FPNFYNDFEVQRYTWKCENQKCVKYLVEDEETSLATCNMLCSEPA 76 Query: 109 YTPKSFYSSCINRKISIINRS 47 PK + NR+ SII+++ Sbjct: 77 IWPKPVHIKLTNRESSIIDKT 97 >AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicase protein. Length = 580 Score = 22.2 bits (45), Expect = 5.3 Identities = 7/23 (30%), Positives = 17/23 (73%) Frame = -3 Query: 302 DLSQNSNFEHNFLSQRNVQNSPL 234 + +N++F FLS++N+Q++ + Sbjct: 417 ETKRNADFLATFLSEQNIQSTSI 439 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 207,247 Number of Sequences: 336 Number of extensions: 4633 Number of successful extensions: 8 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 23348025 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -