BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0909 (847 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_17182| Best HMM Match : Phospholip_A2_1 (HMM E-Value=5.8e-13) 29 4.7 SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) 29 6.3 SB_2985| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 >SB_17182| Best HMM Match : Phospholip_A2_1 (HMM E-Value=5.8e-13) Length = 182 Score = 29.1 bits (62), Expect = 4.7 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +1 Query: 262 DRKLCSKLLFWLKSGGGTKSP 324 D LC ++ FWLK+G TK+P Sbjct: 120 DTSLCFRVRFWLKAGIRTKAP 140 >SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) Length = 1878 Score = 28.7 bits (61), Expect = 6.3 Identities = 15/67 (22%), Positives = 30/67 (44%) Frame = +1 Query: 82 N*NKNFLEYKVDNYKKVCIVEVNFDAVRAEFDQNLCFRIDAKKRL*KTFRNKGLFCTFRC 261 N +N + +VD Y++ C + + + N+C +D +KR K N+ + Sbjct: 1398 NTKENNEDRRVDEYRRKCKSKPGTTKENLDVNANICKNLDKRKRSYKEAMNESAYLEGNV 1457 Query: 262 DRKLCSK 282 +L S+ Sbjct: 1458 KERLSSE 1464 >SB_2985| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 28.3 bits (60), Expect = 8.3 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +3 Query: 309 GNKIASWPTSSETN*SPNDKQKSNDLS 389 GN++A W T + TN S N+ SN+ S Sbjct: 5 GNEVAFWGTQNSTNNSNNNDNSSNNNS 31 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 26,767,823 Number of Sequences: 59808 Number of extensions: 559180 Number of successful extensions: 1222 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1118 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1219 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2395401800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -