BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0909 (847 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AK074803-1|BAC11217.1| 807|Homo sapiens protein ( Homo sapiens ... 30 9.2 AB051390-1|BAB18461.1| 807|Homo sapiens VSGP/F-spondin protein. 30 9.2 AB018305-1|BAA34482.2| 724|Homo sapiens KIAA0762 protein protein. 30 9.2 >AK074803-1|BAC11217.1| 807|Homo sapiens protein ( Homo sapiens cDNA FLJ90322 fis, clone NT2RP2001755, highly similar to Rattus norvegicus f-spondin mRNA. ). Length = 807 Score = 30.3 bits (65), Expect = 9.2 Identities = 12/36 (33%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Frame = -2 Query: 750 CCSPAXPTWRLEXATDWSQ-LHPPMFPIQRLHWSSL 646 CC+ +RL +WS+ HP +P + HWS++ Sbjct: 199 CCACGTAKYRLTFYGNWSEKTHPKDYPRRANHWSAI 234 >AB051390-1|BAB18461.1| 807|Homo sapiens VSGP/F-spondin protein. Length = 807 Score = 30.3 bits (65), Expect = 9.2 Identities = 12/36 (33%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Frame = -2 Query: 750 CCSPAXPTWRLEXATDWSQ-LHPPMFPIQRLHWSSL 646 CC+ +RL +WS+ HP +P + HWS++ Sbjct: 199 CCACGTAKYRLTFYGNWSEKTHPKDYPRRANHWSAI 234 >AB018305-1|BAA34482.2| 724|Homo sapiens KIAA0762 protein protein. Length = 724 Score = 30.3 bits (65), Expect = 9.2 Identities = 12/36 (33%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Frame = -2 Query: 750 CCSPAXPTWRLEXATDWSQ-LHPPMFPIQRLHWSSL 646 CC+ +RL +WS+ HP +P + HWS++ Sbjct: 116 CCACGTAKYRLTFYGNWSEKTHPKDYPRRANHWSAI 151 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 123,345,608 Number of Sequences: 237096 Number of extensions: 2611037 Number of successful extensions: 14683 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 10114 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14683 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 10705443456 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -