BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0909 (847 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT011431-1|AAR99089.1| 1120|Drosophila melanogaster RH64806p pro... 29 6.1 AY058486-1|AAL13715.1| 416|Drosophila melanogaster GM13876p pro... 29 6.1 AE014296-1806|AAF50165.3| 416|Drosophila melanogaster CG32056-P... 29 6.1 AE014296-1219|AAF50588.3| 1120|Drosophila melanogaster CG32381-P... 29 6.1 >BT011431-1|AAR99089.1| 1120|Drosophila melanogaster RH64806p protein. Length = 1120 Score = 29.5 bits (63), Expect = 6.1 Identities = 10/34 (29%), Positives = 20/34 (58%) Frame = -1 Query: 664 SALVEFGFFKNRSPKSCRAD*CIMAVDIMYAKRT 563 +AL + G+++ + P C D C+ ++ Y +RT Sbjct: 727 TALADSGYYEQQGPFRCSDDMCVTVNNVEYVRRT 760 >AY058486-1|AAL13715.1| 416|Drosophila melanogaster GM13876p protein. Length = 416 Score = 29.5 bits (63), Expect = 6.1 Identities = 13/22 (59%), Positives = 13/22 (59%), Gaps = 1/22 (4%) Frame = -3 Query: 746 APQLSPLGDWSXPPIG-PNCTR 684 APQ P GDW P G PNC R Sbjct: 174 APQGGPAGDWMSIPTGIPNCPR 195 >AE014296-1806|AAF50165.3| 416|Drosophila melanogaster CG32056-PA, isoform A protein. Length = 416 Score = 29.5 bits (63), Expect = 6.1 Identities = 13/22 (59%), Positives = 13/22 (59%), Gaps = 1/22 (4%) Frame = -3 Query: 746 APQLSPLGDWSXPPIG-PNCTR 684 APQ P GDW P G PNC R Sbjct: 174 APQGGPAGDWMSIPTGIPNCPR 195 >AE014296-1219|AAF50588.3| 1120|Drosophila melanogaster CG32381-PA protein. Length = 1120 Score = 29.5 bits (63), Expect = 6.1 Identities = 10/34 (29%), Positives = 20/34 (58%) Frame = -1 Query: 664 SALVEFGFFKNRSPKSCRAD*CIMAVDIMYAKRT 563 +AL + G+++ + P C D C+ ++ Y +RT Sbjct: 727 TALADSGYYEQQGPFRCSDDMCVTVNNVEYVRRT 760 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 38,848,287 Number of Sequences: 53049 Number of extensions: 829960 Number of successful extensions: 2184 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2041 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2184 length of database: 24,988,368 effective HSP length: 84 effective length of database: 20,532,252 effective search space used: 4044853644 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -