BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0908 (829 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1687.02 |||CAAX prenyl protease |Schizosaccharomyces pombe|c... 27 2.5 SPBC11C11.04c |alp1||tubulin specific chaperone cofactor D |Schi... 26 5.7 SPAC1F7.09c |||allantoicase |Schizosaccharomyces pombe|chr 1|||M... 26 7.5 SPAP8A3.05 |||ski complex subunit Ski7 |Schizosaccharomyces pomb... 26 7.5 SPCC576.15c |ksg1||serine/threonine protein kinase Ksg1|Schizosa... 26 7.5 >SPAC1687.02 |||CAAX prenyl protease |Schizosaccharomyces pombe|chr 1|||Manual Length = 271 Score = 27.5 bits (58), Expect = 2.5 Identities = 10/19 (52%), Positives = 16/19 (84%) Frame = +1 Query: 304 VITCRCITSLLSSNMSCVM 360 VIT RCI+ LL+S++ C++ Sbjct: 37 VITARCISVLLASSVCCIL 55 >SPBC11C11.04c |alp1||tubulin specific chaperone cofactor D |Schizosaccharomyces pombe|chr 2|||Manual Length = 1107 Score = 26.2 bits (55), Expect = 5.7 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +3 Query: 69 CRSITNIIYVFCQISSHRKI 128 C SIT I+Y FC+I ++ + Sbjct: 84 CNSITVILYQFCKIRGYKAV 103 >SPAC1F7.09c |||allantoicase |Schizosaccharomyces pombe|chr 1|||Manual Length = 342 Score = 25.8 bits (54), Expect = 7.5 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = +3 Query: 414 LQMVEKYSPEAADITASVRDLPTVKTAMGRARLGC 518 ++ VE+ SPE AD + + A+G LGC Sbjct: 3 VENVERLSPEQADAFFGQSSVDLISRALGGQVLGC 37 >SPAP8A3.05 |||ski complex subunit Ski7 |Schizosaccharomyces pombe|chr 1|||Manual Length = 695 Score = 25.8 bits (54), Expect = 7.5 Identities = 9/28 (32%), Positives = 16/28 (57%) Frame = +1 Query: 172 RPQKTYNSKTRDPVVIERSNLVNISKLM 255 +PQK N D ++ + L+ +SKL+ Sbjct: 250 KPQKNTNDSNNDHTLLSQDQLIELSKLV 277 >SPCC576.15c |ksg1||serine/threonine protein kinase Ksg1|Schizosaccharomyces pombe|chr 3|||Manual Length = 592 Score = 25.8 bits (54), Expect = 7.5 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = +2 Query: 470 RSSNCEDSNGPRSAWLRL 523 +S + ED NGP SAW+ L Sbjct: 547 KSWSFEDPNGPASAWVEL 564 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,167,717 Number of Sequences: 5004 Number of extensions: 64133 Number of successful extensions: 176 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 171 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 176 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 406444570 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -