BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0906 (855 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC17H9.01 |cid16||poly|Schizosaccharomyces pombe|chr 1|||Manual 30 0.36 >SPAC17H9.01 |cid16||poly|Schizosaccharomyces pombe|chr 1|||Manual Length = 1202 Score = 30.3 bits (65), Expect = 0.36 Identities = 24/91 (26%), Positives = 41/91 (45%) Frame = -1 Query: 291 QYSLSPTXQWY*VHSAYIPXXXXXXXXXXLKIPTFI*EILTVPCRRVTARNNNNIIQMDS 112 + SL+ + +WY V P + ++T+ + T N++I ++ Sbjct: 519 EVSLNSSLRWYCVAILVTPLQLIINHLKDKTEMLSLDAVMTLILGKNTREVNSSIEEL-K 577 Query: 111 ITQLCCSYVLEFNIPNSFLHYKKNHKSRNLD 19 IT C S++LE NI N+FL Y + N D Sbjct: 578 ITD-CLSFLLEHNIFNTFLVYNEGIVKLNKD 607 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,849,104 Number of Sequences: 5004 Number of extensions: 48740 Number of successful extensions: 96 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 94 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 95 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 424464280 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -