BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0906 (855 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. 24 5.1 AF492464-1|AAM11657.1| 803|Anopheles gambiae beta nu integrin s... 24 6.8 >CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. Length = 1664 Score = 24.2 bits (50), Expect = 5.1 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = -3 Query: 517 GWVRXGSXXPVVGSTKHTRHARNPVQHCARS 425 GW+ G+ +VG T T H + V + R+ Sbjct: 26 GWLATGNVRGIVGVTFTTSHCKKNVDYPLRT 56 >AF492464-1|AAM11657.1| 803|Anopheles gambiae beta nu integrin subunit AgBnu protein. Length = 803 Score = 23.8 bits (49), Expect = 6.8 Identities = 12/43 (27%), Positives = 21/43 (48%) Frame = -1 Query: 144 RNNNNIIQMDSITQLCCSYVLEFNIPNSFLHYKKNHKSRNLDS 16 R + + + + + C + +E N SFL +KN R+ DS Sbjct: 60 RKSRCMTKHELLESKCNALKIETNDDYSFLQIEKNEPHRDFDS 102 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 735,252 Number of Sequences: 2352 Number of extensions: 12686 Number of successful extensions: 24 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 23 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 90959220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -