BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0906 (855 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U32275-1|AAA75370.1| 982|Caenorhabditis elegans serine-threonin... 28 7.4 U11280-5|AAA19437.1| 982|Caenorhabditis elegans Protein kinase ... 28 7.4 U11280-4|AAM97951.2| 353|Caenorhabditis elegans Protein kinase ... 28 7.4 AL161712-18|CAC70140.1| 448|Caenorhabditis elegans Hypothetical... 28 7.4 >U32275-1|AAA75370.1| 982|Caenorhabditis elegans serine-threonine kinase protein. Length = 982 Score = 28.3 bits (60), Expect = 7.4 Identities = 14/47 (29%), Positives = 22/47 (46%), Gaps = 3/47 (6%) Frame = +1 Query: 328 VKQLSSPDPSPLTTDAEVEWVLEVIRY---GLSLPLSEHSAVRDCVR 459 + Q P SP+ T + EW LE +++ L P E + +C R Sbjct: 239 IAQNDPPTLSPIDTSEQPEWSLEFVQFIDKCLRKPAEERMSAEECFR 285 >U11280-5|AAA19437.1| 982|Caenorhabditis elegans Protein kinase protein 18, isoforma protein. Length = 982 Score = 28.3 bits (60), Expect = 7.4 Identities = 14/47 (29%), Positives = 22/47 (46%), Gaps = 3/47 (6%) Frame = +1 Query: 328 VKQLSSPDPSPLTTDAEVEWVLEVIRY---GLSLPLSEHSAVRDCVR 459 + Q P SP+ T + EW LE +++ L P E + +C R Sbjct: 239 IAQNDPPTLSPIDTSEQPEWSLEFVQFIDKCLRKPAEERMSAEECFR 285 >U11280-4|AAM97951.2| 353|Caenorhabditis elegans Protein kinase protein 18, isoformb protein. Length = 353 Score = 28.3 bits (60), Expect = 7.4 Identities = 14/47 (29%), Positives = 22/47 (46%), Gaps = 3/47 (6%) Frame = +1 Query: 328 VKQLSSPDPSPLTTDAEVEWVLEVIRY---GLSLPLSEHSAVRDCVR 459 + Q P SP+ T + EW LE +++ L P E + +C R Sbjct: 239 IAQNDPPTLSPIDTSEQPEWSLEFVQFIDKCLRKPAEERMSAEECFR 285 >AL161712-18|CAC70140.1| 448|Caenorhabditis elegans Hypothetical protein Y66D12A.23 protein. Length = 448 Score = 28.3 bits (60), Expect = 7.4 Identities = 13/46 (28%), Positives = 24/46 (52%) Frame = -3 Query: 544 RLRVEEELGGWVRXGSXXPVVGSTKHTRHARNPVQHCARSVAVTNH 407 +L +E+G +R GS GS +H+R A+ ++ A + V + Sbjct: 43 QLVANKEIGQEIRVGSAIRATGSLEHSRGAQQEMEFVAEQLKVVGN 88 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,163,778 Number of Sequences: 27780 Number of extensions: 280067 Number of successful extensions: 802 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 664 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 802 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2129473654 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -