BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0905 (827 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBP22H7.09c |mis15||kinetochore protein Mis15 |Schizosaccharomy... 29 1.1 SPBC1604.01 |mug158|SPBC1677.01c|sulfatase modifying factor 1 re... 29 1.1 SPBC354.15 |fap1||L-pipecolate oxidase|Schizosaccharomyces pombe... 27 4.3 SPAC19A8.08 |upf2||nonsense-mediated decay protein Upf2|Schizosa... 26 7.5 SPCC965.12 |||dipeptidyl aminopeptidase |Schizosaccharomyces pom... 26 7.5 >SPBP22H7.09c |mis15||kinetochore protein Mis15 |Schizosaccharomyces pombe|chr 2|||Manual Length = 409 Score = 28.7 bits (61), Expect = 1.1 Identities = 14/49 (28%), Positives = 23/49 (46%) Frame = -1 Query: 389 MLMYDTIFVP*INGSYLRPLKKTTIRKTAYNTQSYVISSLRCIQSWQLH 243 M Y T F ++GS LRP+ + T + T V + +WQ++ Sbjct: 212 MFYYTTYFYEMMSGSALRPIDLVSKNLTTFCTNVGVNKEANALGAWQIY 260 >SPBC1604.01 |mug158|SPBC1677.01c|sulfatase modifying factor 1 related|Schizosaccharomyces pombe|chr 2|||Manual Length = 773 Score = 28.7 bits (61), Expect = 1.1 Identities = 14/50 (28%), Positives = 25/50 (50%) Frame = -1 Query: 224 QVLLQVKFNTQCIYYYINLNLNQTQKSSTLHSMRLSVWV*YICRSGICGC 75 ++LL C ++ L+LN+ + L +R + ++ SGICGC Sbjct: 93 KLLLDAFEKKGCDVHFYALDLNEAELQKGLQELRQTTNYQHVKVSGICGC 142 >SPBC354.15 |fap1||L-pipecolate oxidase|Schizosaccharomyces pombe|chr 2|||Manual Length = 412 Score = 26.6 bits (56), Expect = 4.3 Identities = 13/36 (36%), Positives = 18/36 (50%) Frame = -2 Query: 148 RAQPFIV*GYQYGCNTFVGAGYVDVS*TLMGIDALQ 41 RA P ++ G N + + Y D MGIDAL+ Sbjct: 36 RAPPPVIDGSSVDANRIIRSDYADAVYCSMGIDALE 71 >SPAC19A8.08 |upf2||nonsense-mediated decay protein Upf2|Schizosaccharomyces pombe|chr 1|||Manual Length = 1049 Score = 25.8 bits (54), Expect = 7.5 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = -3 Query: 267 MHSVMAVTYINLQFAGTFTGKI*YTMYLLLY 175 + SV V +NL+F+ FTG + +Y LY Sbjct: 97 LSSVKIVWALNLRFSTAFTGPMLANLYCALY 127 >SPCC965.12 |||dipeptidyl aminopeptidase |Schizosaccharomyces pombe|chr 3|||Manual Length = 416 Score = 25.8 bits (54), Expect = 7.5 Identities = 9/22 (40%), Positives = 16/22 (72%) Frame = +2 Query: 755 HKKLVTLHSNFKYGVKVQVANR 820 H K+V H++F Y ++VQ+ N+ Sbjct: 22 HAKIVDTHNDFPYLLRVQLRNK 43 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,439,419 Number of Sequences: 5004 Number of extensions: 72383 Number of successful extensions: 148 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 144 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 148 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 406444570 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -