BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0905 (827 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_01_0179 - 1412391-1412863,1412947-1413412,1413504-1414551,141... 31 0.85 03_05_0001 - 19386264-19386284,19386446-19386517,19386614-193873... 29 6.0 >11_01_0179 - 1412391-1412863,1412947-1413412,1413504-1414551, 1414639-1414725,1416244-1416411,1416785-1416958, 1417662-1417720,1418132-1420154,1420549-1420647, 1420998-1421796,1422101-1422120,1422446-1422513 Length = 1827 Score = 31.5 bits (68), Expect = 0.85 Identities = 20/50 (40%), Positives = 25/50 (50%), Gaps = 2/50 (4%) Frame = -1 Query: 746 SNASTKNP-RVTTTPEPLVFFVKLATSKKVVLC-SQSNL*PKMAKECLNG 603 ++A+ +P R T T + FVK S LC Q NL P ECLNG Sbjct: 987 AHAADLHPNRPTLTTQMRAIFVKTLCSYSTGLCYEQRNLDPAFGPECLNG 1036 >03_05_0001 - 19386264-19386284,19386446-19386517,19386614-19387357, 19387454-19388884,19388953-19389118,19392035-19392114, 19392393-19392462,19392550-19392761,19392837-19392890, 19393471-19393623,19393715-19393930,19394029-19394248, 19394332-19394399,19394510-19394643,19394755-19394854, 19394943-19395421,19395506-19395699,19396270-19396355, 19396364-19396444,19396842-19397023,19397305-19397346, 19398247-19398558,19399374-19399434,19399435-19399617, 19399744-19399863,19400380-19401051,19402597-19402668, 19402742-19402865,19403563-19403651,19405023-19405097 Length = 2170 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = +1 Query: 28 YAWFTAMHQCPLEFNSHPHIPLLQMYYTHTDSLI 129 Y T Q PL+F + H+P LQ Y+ +S++ Sbjct: 2079 YPLNTIQPQVPLQFPNQLHVPQLQFYHQTQESVL 2112 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,422,133 Number of Sequences: 37544 Number of extensions: 394799 Number of successful extensions: 641 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 625 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 639 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2279943096 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -