BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0901 (742 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC4G9.10 |arg3||ornithine carbamoyltransferase Arg3|Schizosacc... 27 2.1 SPBC21C3.01c |vps13a|vps1301, SPBC31F10.18c|chorein homolog|Schi... 27 2.1 SPCC1259.12c |||Ran GTPase binding protein |Schizosaccharomyces ... 26 6.5 SPCC550.14 |||vigilin |Schizosaccharomyces pombe|chr 3|||Manual 25 8.6 >SPAC4G9.10 |arg3||ornithine carbamoyltransferase Arg3|Schizosaccharomyces pombe|chr 1|||Manual Length = 327 Score = 27.5 bits (58), Expect = 2.1 Identities = 20/58 (34%), Positives = 25/58 (43%) Frame = -2 Query: 612 RCHQRNNLQ*AGSARIVSSGSARDQAAVSGASGSCLDGGGQDLGRVDEQRGLPRRCVD 439 R Q + L A I S S R + +V A SCL G LG+ D Q G+ D Sbjct: 43 RSVQMSGLSSQNVAMIFSKRSTRTRVSVESAV-SCLGGNAMFLGKDDIQLGVNESLYD 99 >SPBC21C3.01c |vps13a|vps1301, SPBC31F10.18c|chorein homolog|Schizosaccharomyces pombe|chr 2|||Manual Length = 3071 Score = 27.5 bits (58), Expect = 2.1 Identities = 15/46 (32%), Positives = 24/46 (52%), Gaps = 1/46 (2%) Frame = -1 Query: 277 RSRPSLWC-FRVVTHGASVGESVRFLVLSY*RRERELRIAYVHFVR 143 + +P W + ++ SV ES Y +R R+ RIAY+H +R Sbjct: 328 KEKPLEWFKYAILVVKDSVHESRYHWTWKYFKRRRDDRIAYMHIIR 373 >SPCC1259.12c |||Ran GTPase binding protein |Schizosaccharomyces pombe|chr 3|||Manual Length = 486 Score = 25.8 bits (54), Expect = 6.5 Identities = 16/44 (36%), Positives = 23/44 (52%) Frame = +1 Query: 274 FCRGTIIGVRVDLWNGTLEFYVNREPQGIAFYNLRRHQVLFPMI 405 F G IIG V+ N T+ + N G+AF + VL+P+I Sbjct: 174 FTTGDIIGCGVNFINRTIFYTKNGAYLGVAFKKV--SDVLYPVI 215 >SPCC550.14 |||vigilin |Schizosaccharomyces pombe|chr 3|||Manual Length = 1279 Score = 25.4 bits (53), Expect = 8.6 Identities = 9/26 (34%), Positives = 17/26 (65%) Frame = -2 Query: 480 RVDEQRGLPRRCVDQLHARLGRGRAD 403 +V+E+ +P+RC+ + R+G R D Sbjct: 1038 QVEEKIEVPQRCISSIIGRMGSTRRD 1063 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,824,371 Number of Sequences: 5004 Number of extensions: 55488 Number of successful extensions: 172 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 165 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 172 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 351258950 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -